SecReT6
Protein ID: 227811731
SecReT6 ID335
T6SS typei1
Gene symbol-
Locus tagVCM66_A0103
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012580] [Browse all T6SS(s) in this replicon]
Location [Strand]115133..115417 [+]
Producthypothetical protein
NotePAAR
UniProt IDC3LUC9
KEGG IDvcm:VCM66_A0103
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.20E-18, Aligned region: 19..85
DUF4150 [PF13665], Evalue: 7.40E-05, Aligned region: 22..43
DUF4150 [PF13665], Evalue: 7.40E-05, Aligned region: 59..79
Protein Sequence: 94 a.a.     [Download]
>gi|227811731|ref|YP_002811741.1| hypothetical protein VCM66_A0103 [Vibrio cholerae M66-2]
MGNGIVVGHLGTDHDGFPPTPVTAGSATVRYDGIPAARLGDPLAPHDKPKHPSHGRAIAAGSGTVMIDGK
PVARVGDAVDCGGVLQGASSVNIG
 
Nucleotide Sequence: 285 bp     [Download]
>gi|227811634|ref|NC_012580.1|:115133-115417 Vibrio cholerae M66-2 chromosome II, complete genome
ATGGGTAACGGAATCGTAGTAGGGCATTTAGGTACAGATCATGATGGTTTCCCGCCAACGCCAGTGACCG
CAGGCTCAGCAACTGTGCGTTATGATGGGATTCCAGCTGCTCGGCTTGGGGACCCCTTGGCCCCTCACGA
TAAACCAAAGCATCCCTCGCATGGCCGAGCGATTGCTGCGGGTTCTGGGACGGTGATGATTGATGGAAAA
CCCGTAGCAAGGGTTGGAGATGCGGTCGATTGTGGTGGCGTATTACAGGGAGCAAGCAGTGTCAACATTG
GTTAA