SecReT6
Protein ID: 227811733
SecReT6 ID335
T6SS typei1
Gene symbol-
Locus tagVCM66_A0105
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012580] [Browse all T6SS(s) in this replicon]
Location [Strand]116837..117343 [+]
Producthypothetical protein
NoteTssB
UniProt IDC3LUD1
KEGG IDvcm:VCM66_A0105
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-58, Aligned region: 5..158
Protein Sequence: 168 a.a.     [Download]
>gi|227811733|ref|YP_002811743.1| hypothetical protein VCM66_A0105 [Vibrio cholerae M66-2]
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKNNFEAVMRESE
LKITATVKNKLTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELREALVALKGPLGNIPAFRERL
QSLLNSEESREKLLAELNLLSGQEEPQA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|227811634|ref|NC_012580.1|:116837-117343 Vibrio cholerae M66-2 chromosome II, complete genome
ATGTCTAAAGAAGGAAGTGTAGCTCCCAAAGAGCGGATTAATATCAAGTATATTCCGGCGACGGGGGATG
CACAGGCTGAGGTTGAGCTACCACTCAAAACCCTAGTTGTAGGTGATTTCAAAGGGCATGCGGAGCAAAC
CCCATTGGAAGAGCGTGCAACAGTCACGGTAGATAAGAACAACTTTGAAGCCGTAATGCGCGAGAGCGAG
CTGAAAATCACCGCCACGGTGAAAAACAAGCTGACTGATGATGAGAATGCCGAGCTTCCTGTTGAACTCA
ATTTCAAATCCTTAGCCGACTTCGCTCCTGATGCGGTGGCATCACAAGTTCCAGAACTGAAAAAATTGAT
TGAGTTGCGTGAAGCGTTAGTTGCCCTTAAAGGGCCGCTAGGCAACATTCCCGCATTTCGTGAGCGTTTA
CAGTCATTACTCAACTCAGAAGAGTCGAGAGAAAAGCTGTTGGCAGAACTGAATCTGCTCAGTGGTCAAG
AAGAGCCACAAGCGTAA