SecReT6
Protein ID: 227811734
SecReT6 ID335
T6SS typei1
Gene symbol-
Locus tagVCM66_A0106
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012580] [Browse all T6SS(s) in this replicon]
Location [Strand]117384..118862 [+]
Producthypothetical protein
NoteTssC
UniProt IDC3LUD2
KEGG IDvcm:VCM66_A0106
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-191, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|227811734|ref|YP_002811744.1| hypothetical protein VCM66_A0106 [Vibrio cholerae M66-2]
MMSTTEKVLERPQLAQGSLLDEIMAQTRIAPSEEGYDIAKKGVAAFIENLMGSQHSAEPVNKSLVDQMLV
ELDKKISAQMDEILHNSQFQAMESAWRGLKLFVDRTDFRENNKVEILHVTKDELLEDFEFAPETAQSGLY
KHVYSAGYGQFGGEPVGAIIGNYAFTPSTPDMKLLQYMGALGAMAHAPFISSVGPEFFGIDSFEELPNIK
DLKSTFESPKYTKWRSLRESEDARYLGLTAPRFLLRVPYDPIENPVKSFNYAENVSASHEHYLWGNTAFA
FATRLTDSFAKYRWCPNIIGPQSGGAVEDLPVHVFESMGALQSKIPTEVLITDRKEFELAEEGFIALTMR
KGSDNAAFFSANSIQKPKVFPNTKEGKEAETNYKLGTQLPYMMIINRLAHYVKVLQREQIGAWKERQDLE
RELNSWIKQYVADQENPPADVRSRRPLRAARIEVMDVEGNPGWYQVSLSVRPHFKYMGANFELSLVGRLD
QA
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|227811634|ref|NC_012580.1|:117384-118862 Vibrio cholerae M66-2 chromosome II, complete genome
ATGATGTCTACGACTGAAAAGGTATTGGAAAGGCCACAGCTTGCTCAAGGCAGCCTTCTTGATGAAATTA
TGGCGCAAACCCGTATCGCACCAAGCGAAGAGGGTTACGACATCGCGAAAAAAGGTGTTGCAGCGTTTAT
CGAAAATCTTATGGGTTCACAACACTCTGCTGAGCCTGTCAACAAATCTCTGGTTGACCAAATGTTGGTT
GAACTGGATAAAAAAATCAGTGCACAGATGGATGAAATCCTGCACAACTCACAATTCCAAGCGATGGAAT
CGGCGTGGCGCGGTTTGAAGCTGTTCGTGGATCGCACTGATTTTCGTGAAAATAACAAAGTCGAAATCCT
TCACGTAACCAAAGATGAACTGCTGGAAGATTTCGAGTTTGCTCCAGAAACGGCTCAGTCCGGTCTTTAC
AAGCACGTTTATTCTGCCGGTTATGGTCAATTTGGTGGCGAACCTGTTGGCGCGATCATTGGTAACTATG
CGTTTACCCCTTCAACGCCAGATATGAAGCTGCTGCAATACATGGGCGCACTGGGTGCCATGGCGCATGC
TCCTTTCATTTCAAGCGTAGGTCCTGAATTCTTTGGTATCGACTCCTTCGAAGAACTGCCTAACATTAAA
GATCTCAAGTCGACATTTGAAAGCCCGAAATACACCAAATGGCGTTCACTGCGTGAATCGGAAGATGCTC
GCTATCTTGGTTTGACTGCGCCTCGTTTCCTGCTGCGTGTTCCTTACGATCCAATCGAAAATCCAGTGAA
GTCGTTCAATTATGCGGAAAACGTCAGTGCTTCGCACGAGCACTACCTGTGGGGTAACACGGCATTTGCC
TTCGCAACTCGTTTGACGGATAGCTTTGCTAAATATCGCTGGTGTCCAAACATTATCGGTCCACAAAGTG
GTGGTGCAGTTGAAGATCTGCCGGTGCATGTCTTTGAATCTATGGGTGCATTGCAAAGCAAGATCCCAAC
CGAAGTCCTGATCACGGACCGTAAAGAATTTGAACTGGCGGAAGAAGGTTTTATTGCTCTTACTATGCGT
AAAGGCAGTGATAACGCGGCGTTCTTCTCTGCAAACTCCATTCAAAAACCTAAGGTTTTCCCAAATACCA
AAGAAGGCAAAGAAGCGGAAACCAACTACAAGTTGGGTACCCAGTTGCCGTACATGATGATCATCAACCG
TTTGGCGCACTATGTGAAAGTTCTGCAACGTGAGCAGATCGGTGCTTGGAAAGAGCGTCAAGATCTTGAG
CGTGAACTGAACTCATGGATCAAACAATACGTTGCTGATCAAGAGAACCCACCTGCAGACGTACGTAGCC
GTCGTCCACTTCGTGCTGCGCGCATTGAAGTGATGGATGTGGAAGGCAATCCAGGTTGGTATCAGGTGTC
GCTCTCGGTTCGTCCTCACTTTAAGTACATGGGTGCGAACTTTGAGTTGTCATTAGTTGGACGTCTTGAT
CAAGCCTGA