SecReT6
Protein ID: 227811735
SecReT6 ID335
T6SS typei1
Gene symbol-
Locus tagVCM66_A0107
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012580] [Browse all T6SS(s) in this replicon]
Location [Strand]118865..119302 [+]
Producthypothetical protein
NoteTssE
UniProt IDC3LUD3
KEGG IDvcm:VCM66_A0107
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-20, Aligned region: 37..127
Protein Sequence: 145 a.a.     [Download]
>gi|227811735|ref|YP_002811745.1| hypothetical protein VCM66_A0107 [Vibrio cholerae M66-2]
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAPHLGLVDFNDA
TLETLDLSVRIKLAIQQCLERYEPRLTRVLVRADQDSFNPLTLRFHITATINSEALHEKVQFSLLLDQSR
KYRVF
 
Nucleotide Sequence: 438 bp     [Download]
>gi|227811634|ref|NC_012580.1|:118865-119302 Vibrio cholerae M66-2 chromosome II, complete genome
ATGACGTACATCGCACCTGAAGAGAGTGCATTTGGTGTTGGCTTTTTCGAACGTTTGGAAGCCAACGCCA
AACCTATGTCGCTGACCCGTGGGCCAGACGCGTGGGATGTACTCGAATCGATCAAACGGAATGTCTCTAA
CATTCTGAACACTCGAATTGGTGGAGCGCAAAGTGCCCCTCATCTCGGGTTGGTGGATTTTAATGATGCA
ACGCTGGAAACCTTAGATCTCTCCGTGCGAATTAAATTGGCGATTCAACAGTGCCTTGAGCGCTATGAGC
CGCGTTTAACTCGCGTTCTGGTGAGAGCGGATCAAGATAGCTTTAACCCGCTGACTTTAAGGTTCCACAT
TACCGCGACCATCAATAGCGAAGCGTTACACGAAAAAGTCCAGTTCAGTCTGTTATTGGATCAAAGCAGA
AAATATCGAGTGTTTTAA