SecReT6
Protein ID: 227811737
SecReT6 ID335
T6SS typei1
Gene symbol-
Locus tagVCM66_A0109
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012580] [Browse all T6SS(s) in this replicon]
Location [Strand]121041..122057 [+]
Producthypothetical protein
NoteTssG
UniProt IDC3LUD5
KEGG IDvcm:VCM66_A0109
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-93, Aligned region: 27..325
Protein Sequence: 338 a.a.     [Download]
>gi|227811737|ref|YP_002811747.1| hypothetical protein VCM66_A0109 [Vibrio cholerae M66-2]
MGHTERNAAVDLNSDPAQASPLSLPGNVREYNFYQLVELLQKLADINPESEEWERDCRLVFSANPSLGFS
PSDVMALEARDDERWVMLTNFFGLSGAQSPLPGFILEQLVTEEPGGYKQPFLDFFNNRLINLVYRVWRKY
RYYVRFQPGAQDVFSAQLFALVGLGDPDLRGETPINWCKMLAYAGTLAGRSRSPQVVAGIIAHCFDLPDV
SIRQWVRRRVSIDRSQQLALGKQNARLGMDTVIGESVIDCSGKFIICIKRLSRSRFADFLPSGKEYQPLC
KLVEFILREQMAYDLELAMDEREAPLFCLDTRQNIALGWTSFLGQDAANKHVLIQVRQ
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|227811634|ref|NC_012580.1|:121041-122057 Vibrio cholerae M66-2 chromosome II, complete genome
ATGGGGCACACAGAGCGGAATGCAGCCGTTGATCTGAATTCAGATCCAGCGCAAGCCTCTCCGTTGAGCT
TGCCGGGCAATGTACGGGAATACAACTTCTACCAACTGGTTGAGCTGTTGCAAAAACTGGCTGATATCAA
TCCCGAATCGGAAGAGTGGGAGCGCGATTGCCGCTTGGTGTTCAGTGCTAACCCGAGCCTTGGATTTTCG
CCCAGTGATGTGATGGCGCTTGAAGCGCGTGACGATGAGCGTTGGGTTATGTTGACCAACTTTTTTGGCC
TTTCCGGTGCACAGTCACCTCTGCCGGGGTTCATCCTTGAGCAATTGGTGACGGAAGAGCCTGGGGGATA
TAAGCAGCCGTTTCTCGATTTTTTCAATAACCGATTGATTAATTTGGTTTATCGCGTTTGGCGTAAATAC
CGTTACTACGTACGTTTTCAGCCCGGTGCGCAGGATGTGTTCTCTGCACAGCTGTTTGCGCTGGTGGGGT
TGGGCGATCCTGACCTTCGCGGTGAAACGCCGATCAACTGGTGCAAAATGCTGGCTTACGCGGGCACGCT
GGCCGGACGTAGCCGTTCGCCACAAGTTGTGGCCGGCATTATTGCTCACTGTTTTGATTTACCGGATGTC
TCCATTCGCCAGTGGGTCAGACGTCGGGTATCGATTGATCGGAGTCAGCAACTGGCGCTGGGCAAGCAGA
ATGCGCGGTTGGGGATGGACACGGTGATTGGCGAGTCCGTTATTGATTGCAGTGGAAAATTTATTATCTG
TATCAAACGGTTATCTCGCAGTCGTTTTGCTGATTTTTTGCCCTCCGGTAAAGAGTATCAGCCACTTTGC
AAGCTGGTGGAGTTTATTTTGCGCGAACAGATGGCGTATGACCTCGAGCTGGCGATGGATGAACGAGAAG
CGCCGCTGTTTTGTCTGGATACTAGACAGAATATCGCCCTCGGCTGGACTTCGTTTCTTGGCCAAGATGC
AGCCAATAAACATGTGTTAATTCAAGTAAGGCAATAA