SecReT6
Protein ID: 227811738
SecReT6 ID335
T6SS typei1
Gene symbol-
Locus tagVCM66_A0110
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012580] [Browse all T6SS(s) in this replicon]
Location [Strand]122060..123547 [+]
Producthypothetical protein
NoteFha
UniProt IDC3LUD6
KEGG IDvcm:VCM66_A0110
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-06, Aligned region: 35..102
Protein Sequence: 495 a.a.     [Download]
>gi|227811738|ref|YP_002811748.1| hypothetical protein VCM66_A0110 [Vibrio cholerae M66-2]
MNSVTLPSLTLLVTNAQHLESGLSAQHTWTSSGGVIGSSPNAQWRLVDAQGSVKPMHCEVMMVDGAYCLK
DSCGSTYVNGADMPLGVGQMARLTHKDEVSVGPYRLRVLFGNAIEVEEQYGSLDALFASKDEDLLADLTL
DIEPEKHELPTNTDPLQALDNLMGAAGSSTSLLDDPKSEQPLSAQPSLVPQDNLVLQNADFTPQADSEYE
MTSSIRLKKILGFAKATFAKQTKSEAPNVTSATPTISQYKTSESNVSEGFTMDEKVLDLLEEEVAKSFQP
QLEKSAYSTMHTSSTSQANHLVTGPILEGLGVDLSDENDMNRMHLLSQELGESLQACVRGLLDLHQQVSE
SRFGTLNRNLQPIEDNPLRLGLSYEETIRTLYDADKSVVHLSAPAAIAESLKTVRDHNEAMQFATSEALS
QILNAFSPQVMLRRFHHYKRNSDTTQTSTDAWAWNMYCSYYQELTSNRQRGFEKLFWEIFEQAYDRKIRE
KQLEL
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|227811634|ref|NC_012580.1|:122060-123547 Vibrio cholerae M66-2 chromosome II, complete genome
ATGAACTCAGTGACATTACCTTCGTTGACCCTATTAGTCACCAATGCTCAGCACTTAGAGTCTGGCTTGT
CCGCTCAGCATACGTGGACCTCGTCAGGTGGGGTGATCGGCTCATCGCCGAATGCGCAGTGGCGTTTGGT
CGATGCGCAAGGCAGTGTAAAACCCATGCACTGTGAAGTGATGATGGTAGACGGGGCGTATTGTTTAAAA
GACAGCTGCGGCAGCACGTATGTCAACGGGGCAGACATGCCACTGGGCGTTGGGCAAATGGCACGTCTGA
CTCACAAAGATGAAGTGAGTGTGGGGCCTTACCGTTTGCGAGTGCTGTTTGGTAACGCCATCGAAGTGGA
AGAACAATATGGATCTTTAGATGCGCTGTTTGCCTCTAAGGATGAGGATCTGCTAGCGGATTTGACGCTC
GACATCGAACCAGAAAAACACGAATTACCAACCAATACAGACCCATTACAGGCGCTCGATAACCTGATGG
GTGCGGCGGGCAGTTCGACCTCCTTACTGGATGATCCTAAAAGTGAGCAGCCGTTATCCGCCCAACCTAG
CCTCGTGCCACAAGATAACTTAGTGCTGCAAAATGCCGATTTTACGCCACAAGCGGACAGTGAGTATGAG
ATGACCTCATCGATCCGCCTTAAGAAAATTCTTGGTTTTGCGAAGGCCACCTTTGCTAAGCAAACCAAAT
CAGAAGCACCGAACGTGACTTCTGCCACCCCCACAATTTCTCAATATAAAACCAGCGAAAGCAACGTATC
AGAGGGCTTCACAATGGATGAAAAAGTACTGGATTTGTTAGAAGAGGAAGTCGCGAAAAGTTTCCAACCG
CAGTTGGAGAAAAGCGCGTATTCCACTATGCACACAAGCTCAACCAGCCAAGCTAACCACTTGGTGACAG
GTCCGATCTTGGAAGGGCTCGGCGTAGATCTGAGCGATGAAAATGATATGAATCGTATGCATCTTTTATC
GCAAGAGTTGGGTGAGTCTTTGCAAGCTTGTGTGCGCGGTTTACTCGATTTGCATCAACAAGTGAGTGAA
AGCCGTTTCGGTACTTTGAACCGTAATCTGCAACCCATTGAAGATAACCCGCTGCGTTTAGGTCTCTCCT
ATGAAGAGACGATCCGCACTCTGTACGATGCCGACAAGAGCGTCGTGCACCTTTCTGCCCCTGCGGCGAT
TGCTGAAAGCCTAAAAACCGTTCGCGATCATAATGAAGCGATGCAGTTCGCCACGTCAGAAGCCTTGAGC
CAAATTCTCAACGCTTTCTCACCACAGGTGATGCTGCGCCGTTTCCACCACTACAAGCGCAATTCTGATA
CCACACAAACTTCAACGGATGCTTGGGCGTGGAATATGTACTGCAGCTACTACCAAGAGCTGACCTCTAA
CCGCCAACGCGGCTTTGAGAAGTTGTTCTGGGAGATCTTTGAGCAAGCCTACGATCGCAAAATTCGCGAG
AAGCAACTGGAGCTATAA