SecReT6
Protein ID: 227811743
SecReT6 ID335
T6SS typei1
Gene symbol-
Locus tagVCM66_A0115
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012580] [Browse all T6SS(s) in this replicon]
Location [Strand]128781..130373 [+]
Productsigma-54 dependent transcriptional regulator
NoteVasH
UniProt IDC3LUE1
KEGG IDvcm:VCM66_A0115
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 3.30E-69, Aligned region: 193..359
Sigma54_activ_2 [PF14532], Evalue: 4.10E-23, Aligned region: 171..171
Sigma54_activ_2 [PF14532], Evalue: 4.10E-23, Aligned region: 194..364
AAA_5 [PF07728], Evalue: 7.50E-07, Aligned region: 217..345
HTH_8 [PF02954], Evalue: 8.00E-07, Aligned region: 347..357
HTH_8 [PF02954], Evalue: 8.00E-07, Aligned region: 486..521
Mg_chelatase [PF01078], Evalue: 0.00026, Aligned region: 204..238
Mg_chelatase [PF01078], Evalue: 0.00026, Aligned region: 272..314
AAA_2 [PF07724], Evalue: 0.0056, Aligned region: 214..315
AAA [PF00004], Evalue: 0.0075, Aligned region: 217..330
Protein Sequence: 530 a.a.     [Download]
>gi|227811743|ref|YP_002811753.1| sigma-54 dependent transcriptional regulator [Vibrio cholerae M66-2]
MSQWLAFATQLVGVRKSHQLALQFVDLLTQGLDLSDSLLLLPSSDGRLLVPHDPQRQFAWSVTDFDVPFA
HVLQSSNAMHLTAEELVFWQSNRTFSQLTSRVGMFDSVWIQPLPMDTRQVHSILLLMGESHGIVSAFENA
DFLKFIEVFSQQWSLLNDMEREEQRRLELKQSLTDIERDSAQRSLANALSRTLIGESAAMQKLREQIVSA
ANSQLSVMVQGETGTGKELVAAAVHELSSRKSAPFVAINCAAIPEHLLESELFGYCKGAFSGADSDKQGL
IAQANGGTLFLDEIGDMPLTLQAKLLRVLESRTFRPLGGKQELSSDFRLVSATHVNLLDQVRKKEFRQDL
YYRLFQYPITLPRLAARLEDIELLSEHFVRVFNLQHNTRIRGLNYRAIDCLKQYDFPGNVRELKHLIEFG
CAQTADGTQVEASCFAHRLQTLPCLAPEATPVAVSVETENVDLEPSVALAGEPNFAVIHDLKQAVSQFEA
LIISERLNRFAGDRAKAAKSLGIPKRTLAYKCLKLEIKTP
 
Nucleotide Sequence: 1593 bp     [Download]
>gi|227811634|ref|NC_012580.1|:128781-130373 Vibrio cholerae M66-2 chromosome II, complete genome
ATGAGTCAATGGCTGGCGTTTGCAACCCAATTGGTGGGAGTAAGGAAGTCCCACCAGCTTGCGCTGCAAT
TTGTTGATCTGCTGACTCAAGGCTTAGATCTGAGTGATAGCCTTTTGTTGTTGCCATCGTCGGATGGGCG
TTTACTTGTGCCTCATGATCCACAGCGTCAGTTCGCGTGGTCAGTGACGGATTTTGATGTGCCTTTTGCC
CATGTTTTGCAGTCATCCAATGCGATGCATTTGACCGCGGAAGAGTTGGTATTTTGGCAATCCAATCGCA
CTTTTAGCCAGTTAACCTCTCGCGTGGGGATGTTTGATTCGGTATGGATCCAACCCCTGCCGATGGATAC
TCGTCAAGTACACTCGATCTTGCTGTTGATGGGCGAGAGTCACGGTATCGTGAGCGCTTTTGAAAACGCG
GACTTTTTGAAGTTTATCGAGGTTTTTTCCCAGCAATGGTCACTGCTCAACGATATGGAACGTGAAGAGC
AGCGCCGCTTGGAGCTGAAACAATCGCTGACGGATATTGAACGCGACTCGGCGCAGCGCTCACTGGCCAA
TGCGTTATCGCGTACTTTGATTGGTGAAAGCGCTGCGATGCAAAAGCTGCGTGAGCAGATTGTCTCTGCC
GCTAACTCTCAGCTCTCGGTCATGGTGCAAGGTGAAACTGGCACGGGGAAAGAGTTAGTCGCCGCGGCCG
TGCATGAACTTTCGTCACGTAAGTCTGCGCCGTTTGTTGCGATCAACTGTGCGGCGATCCCTGAGCATCT
ACTGGAAAGTGAACTGTTTGGTTACTGCAAAGGGGCATTTTCTGGAGCGGACAGCGATAAACAGGGACTT
ATCGCACAAGCGAATGGTGGCACGCTATTTCTGGATGAGATCGGCGATATGCCGCTCACCTTACAAGCCA
AATTATTGCGTGTGCTTGAATCGCGTACTTTTCGACCGCTCGGTGGTAAGCAGGAGCTCAGTTCCGATTT
CCGTCTGGTATCTGCCACACACGTCAATCTGCTGGATCAAGTACGCAAAAAAGAATTTCGCCAAGATCTC
TATTACCGTCTATTCCAGTATCCGATCACCTTGCCGCGTTTGGCGGCACGCTTGGAAGATATTGAGCTGC
TCAGTGAGCACTTTGTGCGCGTGTTCAACTTGCAACATAACACGCGCATTCGTGGTTTGAACTATCGAGC
CATCGACTGCCTTAAGCAGTACGACTTCCCGGGAAATGTGCGTGAGCTGAAACATTTGATTGAGTTTGGC
TGCGCGCAAACAGCGGATGGTACGCAGGTGGAAGCTAGTTGCTTTGCCCATCGTTTACAAACCCTACCCT
GTCTTGCGCCTGAAGCGACGCCGGTAGCCGTTTCTGTCGAAACTGAGAACGTGGATCTTGAACCCTCGGT
TGCGCTGGCTGGAGAACCGAATTTTGCGGTTATCCATGATTTGAAACAGGCGGTCAGTCAGTTTGAAGCG
TTGATCATCAGTGAGCGTTTGAACCGCTTTGCTGGCGATCGCGCGAAAGCGGCGAAAAGTCTCGGTATCC
CTAAGCGTACCTTGGCCTACAAGTGCCTGAAATTGGAGATCAAAACCCCATGA