SecReT6
Protein ID: 227811744
SecReT6 ID335
T6SS typei1
Gene symbol-
Locus tagVCM66_A0116
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012580] [Browse all T6SS(s) in this replicon]
Location [Strand]130343..131026 [+]
Producthypothetical protein
NoteVCA0118
UniProt IDC3LUE2
KEGG IDvcm:VCM66_A0116
PDB IDNA
Domain hit(s) vs Pfam DUF3121 [PF11319], Evalue: 5.30E-59, Aligned region: 41..221
Protein Sequence: 227 a.a.     [Download]
>gi|227811744|ref|YP_002811754.1| hypothetical protein VCM66_A0116 [Vibrio cholerae M66-2]
MPEIGDQNPMRITVLVVSLILGCAGSAHVLAASQDAGSQVEQAELCREIPARLERLACFDRVFATPLEQV
AIAPSNPYPAEWQRAMAALSESQSEAGWVLGTQGEGRGSSAWIALPAQNRSSGETSPPVLLLSCINNLSR
IELALPKEVADARIQVSIRHETQFWRSDDHGVLFSSARGMPAIEMMKLAASESRLLLRSNAPFADGLQFD
TRGVNEALDALRERCGW
 
Nucleotide Sequence: 684 bp     [Download]
>gi|227811634|ref|NC_012580.1|:130343-131026 Vibrio cholerae M66-2 chromosome II, complete genome
GTGCCTGAAATTGGAGATCAAAACCCCATGAGAATTACCGTTTTAGTGGTCAGTTTGATCTTGGGTTGCG
CGGGCTCTGCGCATGTTTTAGCAGCATCGCAAGATGCGGGCTCACAGGTTGAGCAAGCTGAGCTGTGCCG
CGAAATTCCTGCGCGTTTAGAGCGTTTGGCTTGTTTTGACCGTGTCTTTGCCACGCCCCTTGAGCAAGTG
GCTATCGCACCGTCCAATCCTTATCCCGCAGAGTGGCAACGCGCCATGGCGGCATTGTCTGAGTCGCAGT
CCGAAGCGGGTTGGGTATTAGGTACGCAAGGTGAAGGGCGGGGCAGCAGCGCTTGGATTGCTTTGCCTGC
GCAAAATCGCAGCTCAGGGGAAACATCTCCGCCAGTGCTCTTGCTCAGTTGCATTAATAACCTGAGCCGC
ATTGAGCTGGCTTTACCGAAAGAAGTGGCTGATGCACGGATTCAAGTCTCTATCCGACACGAGACACAGT
TCTGGCGCAGTGACGATCACGGCGTACTGTTTTCCTCGGCTCGCGGCATGCCTGCGATCGAAATGATGAA
ATTGGCCGCCAGTGAGTCTCGCCTGTTGCTGCGTTCTAATGCGCCCTTTGCTGACGGGTTACAGTTTGAT
ACTCGAGGTGTCAATGAAGCCCTTGATGCTTTGCGCGAACGCTGTGGTTGGTAA