SecReT6
Protein ID: 227811747
SecReT6 ID335
T6SS typei1
Gene symbol-
Locus tagVCM66_A0119
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012580] [Browse all T6SS(s) in this replicon]
Location [Strand]136054..137319 [+]
Producthypothetical protein
NoteTssA
UniProt IDC3LUE5
KEGG IDvcm:VCM66_A0119
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.20E-11, Aligned region: 47..101
Cytochrom_B562 [PF07361], Evalue: 0.0063, Aligned region: 120..136
Cytochrom_B562 [PF07361], Evalue: 0.0063, Aligned region: 172..185
Cytochrom_B562 [PF07361], Evalue: 0.0063, Aligned region: 325..397
Uds1 [PF15456], Evalue: 0.0075, Aligned region: 123..160
Uds1 [PF15456], Evalue: 0.0075, Aligned region: 296..340
Uds1 [PF15456], Evalue: 0.0075, Aligned region: 380..418
Protein Sequence: 421 a.a.     [Download]
>gi|227811747|ref|YP_002811757.1| hypothetical protein VCM66_A0119 [Vibrio cholerae M66-2]
MMSNVIFIDNVCYRLTNDSEEIRGLEPYAKVREEINRRFNPIAGGTDWAVVKEYCEQLACNQGMDFLICG
YYAVACLKTQGLAGYATGMELMSASLANQGECDVKSAKVRKEILDWVNARVVQELKALKPTYESLRDLYR
AERHCERLHQLFEQQQTEYKVDFEGVGFALFEHIDRIETQYHSLLKKQEKAQPPKLKFWQRGYALFTLGV
LGVALGMVGGYWGWPWFYTTPYAAPQRITTLNEASQTQALLNDSSTSERARWQHDLIPLYRDTLQQNLTI
SFSEPKRHAITQLNLLRTLYPENEQVNALSQEFALQQQQALEQTALFVAKFSEIRTKMANISLLAKRGKW
AELEKQTKSLEEFAVSLSPIYGRVDYVQGLLEQGDVTNAQKEFAILKQRLDSLSWKIAELEQRIGDAALL
Q
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|227811634|ref|NC_012580.1|:136054-137319 Vibrio cholerae M66-2 chromosome II, complete genome
GTGATGTCCAATGTGATTTTTATTGATAACGTTTGCTACCGATTAACCAATGATTCTGAGGAGATTCGCG
GATTAGAGCCCTATGCGAAGGTTCGTGAGGAGATAAACCGCCGCTTCAATCCGATTGCTGGGGGCACGGA
TTGGGCAGTGGTAAAAGAGTACTGTGAACAACTGGCCTGTAACCAAGGAATGGATTTTCTGATCTGCGGT
TACTATGCGGTAGCCTGCCTGAAAACTCAGGGGTTAGCGGGGTATGCCACCGGTATGGAGCTGATGAGTG
CAAGCCTTGCCAACCAAGGTGAGTGTGATGTGAAAAGCGCCAAAGTGCGCAAAGAGATCCTTGATTGGGT
CAATGCACGTGTGGTGCAGGAACTGAAAGCACTTAAGCCAACTTATGAGTCGCTGCGAGATCTGTATCGG
GCTGAGCGCCATTGCGAGCGGTTACATCAGCTGTTTGAACAGCAACAAACCGAATACAAAGTAGACTTTG
AAGGGGTCGGGTTTGCTCTGTTTGAACACATAGACAGAATTGAAACCCAATACCACAGCTTATTGAAAAA
GCAGGAGAAGGCTCAGCCACCTAAGCTTAAGTTTTGGCAGCGCGGTTACGCGTTGTTCACTCTAGGTGTA
CTCGGGGTTGCACTGGGAATGGTGGGGGGCTACTGGGGGTGGCCTTGGTTTTATACCACGCCTTATGCCG
CGCCACAGCGCATCACTACGTTGAATGAGGCCTCTCAAACTCAAGCACTGCTCAACGACTCTTCCACAAG
TGAGCGTGCGCGTTGGCAACATGATCTGATCCCGCTGTATCGCGATACTTTGCAGCAGAATTTAACCATC
TCGTTTAGTGAACCTAAGCGACATGCCATCACTCAGCTGAATCTATTGCGCACTCTTTATCCTGAAAACG
AGCAAGTGAATGCACTGAGTCAAGAGTTTGCCCTTCAGCAGCAACAAGCGTTGGAGCAAACCGCGCTGTT
CGTGGCTAAGTTCAGCGAAATTCGCACCAAAATGGCCAATATCTCGTTATTGGCTAAGCGAGGGAAATGG
GCTGAGTTAGAAAAGCAGACCAAATCATTAGAAGAGTTCGCGGTCAGCCTATCACCGATTTATGGTCGAG
TTGACTATGTGCAAGGCCTCCTTGAACAGGGCGATGTCACAAATGCCCAGAAAGAGTTTGCGATCCTCAA
ACAAAGGCTAGATAGCCTAAGTTGGAAAATTGCCGAGCTTGAGCAGCGTATCGGCGATGCGGCTTTGTTG
CAGTGA