SecReT6
Protein ID: 227811750
SecReT6 ID335
T6SS typei1
Gene symbol-
Locus tagVCM66_A0122
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012580] [Browse all T6SS(s) in this replicon]
Location [Strand]140622..140990 [+]
Producthypothetical protein
NoteTsiV3 (i)
UniProt IDC3LUE8
KEGG IDvcm:VCM66_A0122
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 122 a.a.     [Download]
>gi|227811750|ref|YP_002811760.1| hypothetical protein VCM66_A0122 [Vibrio cholerae M66-2]
MNNLLSAYVTMLLILLSISGGAIASENCNDTSGVHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDF
YSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS
 
Nucleotide Sequence: 369 bp     [Download]
>gi|227811634|ref|NC_012580.1|:140622-140990 Vibrio cholerae M66-2 chromosome II, complete genome
ATGAATAACTTGCTTTCTGCGTATGTAACTATGCTGTTGATATTATTAAGTATTAGTGGTGGCGCTATTG
CTAGTGAAAACTGCAATGATACATCTGGAGTGCATCAAAAAATTCTAGTGTGTATCCAAAATGAGATAGC
TAAGTCAGAGACTCAGATTAGAAATAATATTTCTTCTAAGTCTATAGATTATGGCTTTCCTGATGATTTC
TACAGCAAGCAAAGATTAGCTATTCATGAAAAGTGTATGCTTTATATAAATGTCGGTGGCCAACGTGGTG
AATTGCTAATGAACCAATGTGAACTTTCGATGCTACAAGGCCTTGATATTTACATTCAACAGTATATAGA
GGATGTTGATAATAGTTAG