SecReT6
Protein ID: 228993424
SecReT6 ID180
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0341
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]309005..310108 [+]
ProductImpA, N-terminal
NoteTssA
UniProt IDA3NG76
KEGG IDbpd:BURPS668_A0341
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.90E-21, Aligned region: 68..128
ImpA-rel_N [PF06812], Evalue: 7.90E-21, Aligned region: 140..154
ImpA-rel_N [PF06812], Evalue: 7.90E-21, Aligned region: 204..220
Protein Sequence: 367 a.a.     [Download]
>gi|228993424|ref|YP_001061347.2| ImpA, N-terminal [Burkholderia pseudomallei 668]
MTPSRKPAGRAAAARTPKPDGWMAPVDAVAPCGADLEYDPEFVVLAAKVAPRAEAQYGDFVGSPEPVNWS
DVERDCRRLMMRSKDMRLAVLFARSRTRLAGATGLAEGIGLLAAWLAAFPDAIHPQADVDADRDAALEIR
RNALQALTDADGLLADVREIALTRSSATRLQVRDVERAFAQPRPGDALAPESVVRQLDDLHAQQPETLAG
FGDALAGLAAIGAWSGEHLGDYAPDLSALDALLRRIAGANARGDRAEAEPIAPAEADAPPASEAAAVHAH
ASPPRRREPAAQALAAAIAGEPAAQPVDRYAARELIRQARQWFEQHEPSSPIPILLRRAEHFVGKRYADV
VQAIPAELLALWSADET
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|126442307|ref|NC_009075.1|:309005-310108 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGACCCCCAGCAGAAAACCGGCCGGCAGGGCGGCTGCCGCGCGCACGCCGAAGCCCGACGGCTGGATGG
CGCCCGTCGATGCGGTCGCGCCGTGCGGAGCGGACCTTGAATACGATCCCGAGTTCGTCGTGCTCGCGGC
GAAGGTCGCGCCGCGCGCCGAAGCGCAGTACGGGGACTTCGTCGGCTCGCCGGAGCCGGTGAACTGGAGC
GACGTCGAGCGCGACTGCCGACGGCTGATGATGCGCAGCAAGGACATGCGCCTCGCGGTGCTGTTCGCGC
GCAGCCGCACGCGGCTTGCCGGCGCGACCGGGCTCGCGGAAGGCATTGGCTTGCTGGCCGCGTGGCTCGC
CGCGTTTCCCGATGCGATTCATCCGCAAGCCGACGTCGACGCGGACCGCGACGCGGCGCTCGAGATCCGG
CGCAACGCGCTGCAGGCGCTGACCGATGCCGACGGGCTGCTGGCGGACGTGCGCGAGATCGCGCTGACCC
GCTCGAGCGCGACGCGCCTGCAGGTGCGCGACGTGGAACGCGCGTTCGCGCAACCGCGGCCCGGCGATGC
GCTCGCGCCGGAATCGGTCGTGCGCCAGCTCGACGATTTGCACGCGCAGCAGCCGGAGACGCTCGCGGGC
TTCGGCGATGCGCTCGCGGGGCTGGCCGCGATCGGCGCCTGGAGCGGCGAGCATCTCGGCGATTATGCGC
CGGACCTGTCGGCGCTCGATGCGCTGCTGCGCCGGATCGCGGGCGCGAACGCGCGCGGCGATCGCGCGGA
GGCCGAGCCGATCGCGCCGGCCGAAGCCGATGCGCCGCCGGCGAGCGAGGCGGCGGCCGTGCACGCACAC
GCATCGCCGCCGCGGCGGCGCGAGCCCGCGGCGCAGGCGCTCGCGGCTGCCATTGCGGGCGAACCGGCCG
CGCAGCCGGTGGATCGTTACGCGGCGCGCGAGCTGATCCGGCAGGCGCGCCAGTGGTTCGAGCAGCACGA
GCCGAGCAGCCCGATTCCGATTCTGCTCAGGCGCGCGGAGCATTTCGTCGGCAAGCGCTATGCGGATGTG
GTGCAGGCGATTCCCGCCGAGCTGCTCGCGCTGTGGAGCGCGGACGAAACCTGA