SecReT6
Protein ID: 229008322
SecReT6 ID167
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_0913
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]925000..926103 [-]
Producthypothetical protein
NoteTssA
UniProt IDA1UX09
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.90E-21, Aligned region: 68..128
ImpA-rel_N [PF06812], Evalue: 7.90E-21, Aligned region: 140..154
ImpA-rel_N [PF06812], Evalue: 7.90E-21, Aligned region: 204..220
Protein Sequence: 367 a.a.     [Download]
>gi|229008322|ref|YP_990512.2| hypothetical protein BMASAVP1_0913 [Burkholderia mallei SAVP1]
MTPSRKPAGRAAAARTPKPDGWMAPVDAAAPCGADLEYDPEFVVLAAKVAPRAEAQYGDFVGSPEPVNWS
DVERDCRRLMMRSKDMRLAVLFARSRTRLAGATGLAEGIGLLAAWLAAFPDAIHPQADVDADRDAALEIR
RNALQALTDADGLLADVREIALTRSSATRLQVRDVERAFAQPRPGDALAPESVVRQLDDLHAQQPETLAG
FGDALAGLAAIDAWSGEHLGDYAPDLSALDALLRRIAGANARGDRAEAEPIAPAEADAPPASEAAAAHAH
ASPPRRREPAAQALAAAIAGEPAAQPVDRYAARELIRQARQWFEQHEPSSPIPILLRRAEHFVGKRYADV
VQAIPAELLALWSADET
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c926103-925000 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGACCCCCAGCAGAAAACCGGCCGGCAGGGCGGCTGCCGCGCGTACGCCGAAGCCCGACGGCTGGATGG
CGCCCGTCGATGCGGCCGCGCCGTGCGGAGCGGACCTTGAATACGATCCCGAGTTCGTCGTGCTCGCGGC
GAAGGTCGCGCCGCGCGCCGAAGCGCAGTACGGGGACTTCGTCGGCTCGCCGGAGCCGGTGAACTGGAGC
GACGTCGAGCGCGACTGCCGACGGCTGATGATGCGCAGCAAGGACATGCGCCTCGCGGTGCTGTTCGCGC
GCAGCCGCACGCGGCTTGCCGGCGCGACCGGGCTCGCGGAAGGCATTGGCTTGCTGGCCGCGTGGCTCGC
CGCGTTTCCCGATGCGATTCATCCGCAAGCCGACGTCGACGCGGACCGCGACGCGGCGCTCGAGATCCGG
CGCAACGCGCTGCAGGCGCTGACCGATGCCGACGGGCTGCTGGCGGACGTGCGCGAGATCGCGCTGACCC
GCTCGAGCGCGACGCGCCTGCAGGTGCGCGACGTGGAACGCGCGTTCGCGCAACCGCGGCCCGGCGATGC
GCTCGCGCCGGAATCGGTCGTGCGCCAGCTCGACGATTTGCACGCGCAGCAGCCGGAGACGCTCGCGGGC
TTCGGCGATGCGCTCGCGGGGCTGGCCGCGATCGACGCCTGGAGCGGCGAGCATCTCGGCGATTATGCGC
CGGACCTGTCGGCGCTCGATGCGCTGCTTCGCCGGATCGCGGGCGCGAACGCGCGCGGCGATCGCGCGGA
GGCCGAGCCGATCGCGCCGGCCGAAGCCGATGCGCCGCCGGCGAGCGAGGCGGCGGCCGCGCACGCGCAC
GCATCGCCGCCGCGGCGGCGCGAGCCCGCGGCGCAGGCACTCGCGGCTGCCATTGCGGGCGAACCGGCCG
CGCAGCCGGTGGATCGTTACGCGGCGCGCGAGCTGATCCGGCAGGCGCGCCAGTGGTTCGAGCAGCACGA
GCCGAGCAGCCCGATTCCGATTCTGCTCAGGCGCGCGGAGCATTTCGTCGGCAAGCGCTATGCGGATGTG
GTGCAGGCGATTCCCGCCGAGCTGCTCGCGCTGTGGAGCGCGGACGAAACCTGA