SecReT6
Protein ID: 229590988
SecReT6 ID786
T6SS typei1
Gene symbol-
Locus tagPFLU3545
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]3932284..3933030 [-]
Producthypothetical protein
NoteTssL
UniProt IDC3K7U5
KEGG IDpfs:PFLU3545
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.70E-61, Aligned region: 23..225
Protein Sequence: 248 a.a.     [Download]
>gi|229590988|ref|YP_002873107.1| hypothetical protein PFLU3545 [Pseudomonas fluorescens SBW25]
MEDRMIYTAHLQGAPPFKMGSNILLAAAWELLLQVVQLKAGPGRESLQALNEQLSSGVNAFEARALHQGV
ENSQVMSARYVLCSVIDEAVVTTSWGSRSDWSKTSLLSLFHNETFGGEKFFQLLERLSRDPVKHVAMLEL
MYVCLSLGFEGKYRVMERGRVQLETLHDAVYRQIRHVRGDRLPVCISPETGRASQARIRLVSTTWVVICV
VACLLAMYSGFAWMLGQERMTALQPFQSSVSVPSRTPL
 
Nucleotide Sequence: 747 bp     [Download]
>ref|NC_012660.1|:c3933030-3932284 hypothetical protein PFLU3545 [Pseudomonas fluorescens SBW25]
TTGGAAGACCGCATGATCTATACCGCCCACCTGCAGGGCGCACCGCCATTCAAGATGGGTTCGAATATTT
TATTGGCAGCCGCCTGGGAGCTCTTGTTGCAGGTTGTTCAGCTCAAGGCCGGTCCTGGTCGGGAAAGCCT
GCAGGCACTCAATGAACAGCTGTCATCGGGCGTCAACGCGTTTGAGGCGCGTGCCTTGCACCAAGGCGTA
GAGAACAGTCAGGTGATGTCGGCGCGTTATGTGCTGTGCAGTGTCATTGATGAGGCTGTGGTCACGACGT
CTTGGGGCAGTCGTAGCGACTGGTCGAAGACCAGCCTGCTGAGCCTCTTCCATAACGAAACTTTCGGCGG
TGAAAAATTTTTCCAACTGCTGGAGCGATTGTCCCGCGACCCCGTCAAGCATGTGGCCATGCTGGAGCTT
ATGTACGTGTGCCTGTCGTTGGGTTTCGAAGGTAAATATCGCGTCATGGAGCGGGGGCGGGTGCAGCTTG
AAACCCTGCACGATGCGGTGTACCGCCAGATCAGGCATGTGCGCGGTGATCGGCTGCCGGTATGCATTTC
GCCGGAAACGGGTAGGGCCTCTCAGGCGCGGATTCGCCTTGTCTCCACCACCTGGGTCGTCATCTGTGTA
GTGGCCTGTTTGCTCGCGATGTATTCAGGGTTCGCCTGGATGTTGGGCCAGGAGCGCATGACGGCGCTGC
AACCTTTTCAATCTTCGGTGTCAGTCCCGTCTCGGACGCCCTTGTAA