SecReT6
Protein ID: 229590989
SecReT6 ID786
T6SS typei1
Gene symbol-
Locus tagPFLU3546
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]3933015..3933500 [-]
Producthypothetical protein
NoteTssE
UniProt IDC3K7U6
KEGG IDpfs:PFLU3546
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.60E-17, Aligned region: 21..112
Protein Sequence: 161 a.a.     [Download]
>gi|229590989|ref|YP_002873108.1| hypothetical protein PFLU3546 [Pseudomonas fluorescens SBW25]
MPHYQSLFERLERPATTRACGVTSVALHLGKMLSIRAGSVQTLPDYGLPDLNDMNQSLHESLSQSRVLIE
RFIRAYEPRLKQVRVKTLPRDHDPLALAFAIEATLVIKGAEQPVVFTARLWTVNTRRMKKPCCLTVKGWA
RCGAPSRTTRRRLASSSWKTA
 
Nucleotide Sequence: 486 bp     [Download]
>ref|NC_012660.1|:c3933500-3933015 hypothetical protein PFLU3546 [Pseudomonas fluorescens SBW25]
ATGCCCCACTACCAAAGCCTTTTCGAGCGACTCGAGCGTCCGGCGACGACCCGGGCGTGTGGCGTGACAT
CGGTTGCACTCCATCTGGGGAAAATGCTCAGCATCCGTGCGGGCAGTGTGCAGACACTGCCCGACTACGG
CTTGCCCGACCTTAATGATATGAATCAGAGCCTGCATGAATCATTGAGTCAGTCGCGCGTGTTGATCGAG
CGATTTATCCGCGCCTACGAGCCGCGCTTGAAGCAGGTGCGGGTCAAGACATTGCCACGGGATCATGATC
CGTTGGCCCTGGCGTTCGCTATCGAAGCCACACTGGTGATCAAGGGTGCCGAGCAACCCGTGGTGTTTAC
CGCGCGGTTATGGACAGTGAATACCCGCAGGATGAAAAAACCGTGCTGCTTGACCGTGAAGGGTTGGGCC
CGGTGCGGGGCGCCGTCACGGACTACCCGTCGCCGCCTCGCTTCGAGCAGTTGGAAGACCGCATGA