SecReT6
Protein ID: 229590990
SecReT6 ID786
T6SS typei1
Gene symbol-
Locus tagPFLU3547
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]3933515..3934990 [-]
Producthypothetical protein
NoteTssC
UniProt IDC3K7U7
KEGG IDpfs:PFLU3547
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.40E-189, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|229590990|ref|YP_002873109.1| hypothetical protein PFLU3547 [Pseudomonas fluorescens SBW25]
MTTPQHALPAQTADEYSILDNIVAQTLLSADDEAYGIAKRGVSAFIEELIKPQNRGEPVKKRLVDRMIAE
IDTKLSLQMDEILHHPDFQALEASWKGLQLLVDRTDFRENIKIELLNVSRQDLLEDFEDSPEVTQSGLYK
HIYSAEYGQFGGQPVGAIIANYFLSPSAPDVKLMQYASSVACMAHAPFIAAAAPAFFGLESFTGLPDLKD
LKDHFEGPQFAKWQSFRQSEDARYIGLTVPRFLLRTPYDPLECPVKTFAYQENVVNSHEHYLWGNTAYAF
ATRLTDSFARFRWCPNIIGPQSGGAVEDLPLHHFHSMGEIETKIPTEVLVSDRREYELAQEGFIALTMRK
GSDNAAFFSASSVQKPKHFGLSPEGKEAELNYRLGTQLPYMMVVNRLAHYLKVLQREQLGSWKERTDLEL
ELNKWIRQYVADQENPSAEVRGRRPLRAARIVVSDVEGEPGWYRVNLSVRPHFKYMGADFTLSLVGKLDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>ref|NC_012660.1|:c3934990-3933515 hypothetical protein PFLU3547 [Pseudomonas fluorescens SBW25]
ATGACCACACCACAACACGCGCTACCGGCACAAACCGCTGATGAATACAGCATCCTCGACAACATCGTTG
CCCAGACGCTACTGAGTGCCGATGACGAAGCGTATGGCATTGCCAAACGGGGTGTCTCGGCGTTTATCGA
AGAGTTGATCAAGCCGCAGAACCGTGGCGAGCCGGTAAAAAAACGCTTGGTCGACCGGATGATTGCCGAG
ATCGACACCAAGCTCAGTCTGCAAATGGACGAGATATTGCACCACCCGGACTTTCAGGCCCTGGAAGCGT
CCTGGAAAGGGCTCCAGTTGTTGGTGGATCGCACCGACTTTCGCGAAAACATCAAGATCGAACTCTTGAA
CGTTTCCCGGCAAGACCTGCTGGAAGACTTCGAAGACTCACCGGAAGTGACCCAGTCGGGCTTGTACAAA
CATATCTACAGTGCTGAATACGGCCAGTTTGGCGGTCAGCCTGTGGGCGCGATCATTGCCAACTATTTTC
TGTCGCCCAGCGCGCCTGATGTAAAGCTGATGCAATACGCTTCCAGTGTGGCTTGCATGGCGCATGCGCC
CTTTATCGCCGCAGCCGCGCCAGCGTTCTTCGGGTTGGAGAGCTTCACCGGCTTACCGGATCTCAAAGAT
CTGAAGGACCATTTCGAAGGCCCGCAATTTGCCAAATGGCAAAGCTTTCGCCAGAGCGAGGACGCGCGTT
ACATCGGGTTGACCGTGCCGCGTTTCTTGCTCCGTACGCCTTATGACCCCCTCGAATGCCCGGTCAAGAC
CTTTGCCTACCAGGAAAACGTGGTCAACAGCCACGAACATTACCTGTGGGGCAATACAGCCTACGCCTTT
GCCACGCGCCTGACCGATAGCTTCGCGCGCTTTCGCTGGTGCCCGAACATCATCGGCCCGCAAAGCGGTG
GCGCGGTAGAAGACTTGCCGTTGCATCACTTCCACAGCATGGGGGAGATTGAAACCAAGATCCCGACCGA
AGTGCTGGTTTCCGACCGTCGTGAATACGAACTGGCGCAAGAGGGCTTCATTGCCTTGACGATGCGCAAG
GGCAGTGACAACGCCGCGTTCTTCTCTGCCAGCTCGGTACAAAAGCCGAAACACTTCGGCCTCAGCCCCG
AGGGCAAGGAAGCAGAGCTGAATTACCGCTTGGGAACACAGTTGCCCTACATGATGGTGGTCAATCGCCT
GGCCCATTACCTCAAGGTCCTTCAGCGCGAACAACTGGGTTCATGGAAGGAGCGCACCGACCTGGAGCTG
GAGCTCAATAAATGGATTCGCCAGTACGTCGCCGACCAGGAAAACCCCAGTGCCGAAGTGCGCGGGCGGC
GCCCCTTGCGCGCAGCACGCATCGTTGTCAGTGATGTCGAGGGTGAGCCTGGCTGGTATCGCGTCAACCT
GAGTGTGCGACCGCACTTCAAGTACATGGGGGCGGATTTCACGCTGTCCCTGGTTGGCAAGCTCGATAAA
GAATGA