SecReT6
Protein ID: 229590991
SecReT6 ID786
T6SS typei1
Gene symbol-
Locus tagPFLU3548
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]3935018..3935515 [-]
Producthypothetical protein
NoteTssB
UniProt IDC3K7U8
KEGG IDpfs:PFLU3548
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.70E-53, Aligned region: 5..159
Protein Sequence: 165 a.a.     [Download]
>gi|229590991|ref|YP_002873110.1| hypothetical protein PFLU3548 [Pseudomonas fluorescens SBW25]
MAKEGSVAPKERINITFKPAIGGAQEEVELPLKLLVLGDFTQREDARKLEDRKPIAIDKNTLDDVLAKQA
LSLTLNVPNRLQEDAHVEELAIQVRINAMKDFNPANLVEQVPELHKLMALREALMALKGPLGNTPSFRKA
IEQALADDESRARVLAELGLGSPDA
 
Nucleotide Sequence: 498 bp     [Download]
>ref|NC_012660.1|:c3935515-3935018 hypothetical protein PFLU3548 [Pseudomonas fluorescens SBW25]
ATGGCCAAAGAAGGTTCGGTAGCCCCCAAGGAACGTATCAATATCACGTTCAAACCCGCCATCGGCGGGG
CGCAGGAAGAAGTCGAACTGCCGTTGAAACTATTGGTGCTGGGAGATTTCACCCAACGTGAGGACGCGCG
CAAGCTTGAAGATCGCAAACCCATCGCGATCGACAAAAACACCCTTGATGACGTGCTGGCCAAACAGGCG
TTGAGCCTGACGCTGAATGTGCCCAATCGTCTGCAGGAGGATGCGCACGTTGAGGAGCTGGCCATTCAGG
TACGCATTAACGCCATGAAGGATTTCAATCCCGCGAACCTGGTTGAGCAGGTTCCGGAGTTGCACAAGCT
GATGGCGTTGCGCGAGGCACTGATGGCTCTCAAGGGCCCACTGGGCAACACCCCGAGCTTTCGCAAGGCC
ATCGAACAGGCCCTGGCCGATGACGAGTCCCGCGCGCGGGTACTGGCCGAGCTGGGCCTGGGCAGCCCGG
ACGCCTGA