SecReT6
Protein ID: 229590992
SecReT6 ID786
T6SS typei1
Gene symbol-
Locus tagPFLU3549
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]3935547..3937100 [-]
Producthypothetical protein
NoteTssA
UniProt IDC3K7U9
KEGG IDpfs:PFLU3549
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.70E-21, Aligned region: 55..114
ImpA-rel_N [PF06812], Evalue: 4.70E-21, Aligned region: 256..264
ImpA-rel_N [PF06812], Evalue: 4.70E-21, Aligned region: 325..344
Protein Sequence: 517 a.a.     [Download]
>gi|229590992|ref|YP_002873111.1| hypothetical protein PFLU3549 [Pseudomonas fluorescens SBW25]
MAYSDKLYDYYLELARSPCMPTSFAGSDMRFSSEYEVLEFELAKARSIHGSGQPDWHKVLEAGEILLRQQ
SKDLRVAVWLTWALHQRESYPGLLAGLGLLRYFCEHHWSEVHPGKPRTRGAAFGWLVLRLEPLFTLSLPL
QNQQPLFQAVLEHLIRLDELWAEYLGDAAPMLLPIRRQLAQRLERAAQDDAPVAGLSGVIAHVKQATTQL
LKPEARVDNEKDAHRLLRTLQEQARTLCVWWLRQNATDLRAFRLNRTLTWLALANYPDADNERLTALRGP
APDKLKRYQERFAQGHHADLVLELEASLAGAMFWFDGLHMLWECLEAMQAEQAMTELEVTFALLLQRLPN
LAEFRFHDGAPFAGPATRDWIALQVTRHLQIPESPALIVDADAEPWEIALQAVATRLRKDGLKAAIHELK
QGMYAARSDRARFYWRLAQARLCVLAGKHELAKIQLEQLDHELQHTGLERWEPELALQVTQLLYRCCDLL
PQNHAVRERKEDTHRRLCLFDLEAVLE
 
Nucleotide Sequence: 1554 bp     [Download]
>ref|NC_012660.1|:c3937100-3935547 hypothetical protein PFLU3549 [Pseudomonas fluorescens SBW25]
ATGGCTTATTCGGACAAGCTGTATGATTATTACCTTGAACTTGCACGGTCGCCCTGCATGCCAACAAGTT
TTGCGGGCAGTGATATGCGCTTTTCGAGTGAATATGAGGTCCTGGAGTTCGAGCTTGCCAAGGCACGATC
AATTCATGGCAGTGGTCAACCCGATTGGCATAAGGTCCTGGAAGCTGGCGAAATCCTGTTGCGCCAGCAA
TCCAAGGACCTGCGGGTCGCCGTTTGGCTGACCTGGGCGCTGCACCAGAGGGAATCCTACCCAGGGTTGT
TGGCCGGGCTCGGGTTGTTGCGCTATTTCTGCGAGCATCATTGGTCTGAGGTCCACCCCGGAAAACCACG
CACACGTGGCGCGGCATTCGGATGGTTGGTGTTGCGCCTTGAGCCCTTGTTCACGCTAAGCCTGCCGCTC
CAGAACCAGCAGCCTTTGTTCCAGGCGGTGCTTGAACACCTGATACGCCTCGATGAGCTGTGGGCCGAGT
ACTTGGGGGATGCCGCGCCAATGTTGTTGCCGATTCGCAGGCAATTGGCTCAGCGACTGGAGCGCGCTGC
GCAGGACGACGCCCCGGTCGCAGGGCTGAGTGGTGTCATTGCGCACGTCAAGCAGGCGACCACCCAATTG
CTCAAGCCCGAAGCGCGGGTGGACAACGAAAAAGACGCCCACAGGTTGTTGCGCACCTTGCAGGAACAGG
CGCGCACGCTGTGCGTATGGTGGTTGCGTCAGAACGCCACCGACCTGCGCGCTTTTCGCCTGAACCGAAC
ATTGACCTGGCTGGCGCTGGCCAATTATCCGGATGCCGACAACGAACGGCTCACCGCCCTGCGTGGGCCC
GCTCCCGACAAGCTCAAGCGTTATCAGGAGCGTTTTGCCCAAGGTCATCACGCCGATCTGGTGCTCGAAC
TTGAAGCCAGTCTCGCCGGTGCGATGTTCTGGTTCGATGGGCTGCACATGCTCTGGGAATGCCTGGAGGC
CATGCAGGCCGAGCAGGCCATGACTGAGCTGGAGGTGACCTTCGCTCTGTTGCTGCAACGTTTGCCAAAC
CTGGCGGAGTTTCGCTTTCACGACGGGGCTCCTTTTGCCGGCCCCGCGACCCGTGACTGGATAGCGCTGC
AAGTTACCCGTCACCTGCAAATACCCGAATCGCCTGCATTGATAGTTGATGCCGACGCCGAGCCGTGGGA
GATCGCCTTGCAGGCGGTCGCAACCCGCTTACGCAAGGACGGGCTCAAGGCCGCCATCCATGAACTCAAA
CAAGGCATGTATGCCGCTCGCAGTGATCGCGCACGTTTTTATTGGCGGTTGGCCCAAGCGCGTCTGTGTG
TATTGGCGGGCAAGCATGAGCTGGCGAAGATCCAGCTCGAACAGCTGGACCACGAACTGCAACACACAGG
CCTGGAGCGCTGGGAGCCGGAGCTGGCCCTTCAAGTGACACAGCTTCTCTACCGCTGCTGCGACCTGTTG
CCACAAAACCACGCCGTGCGCGAGCGCAAGGAAGACACCCATCGCAGGCTGTGCCTCTTCGATCTGGAAG
CGGTACTTGAATAG