SecReT6
Protein ID: 229605182
SecReT6 ID336
T6SS typei1
Gene symbol-
Locus tagVCD_000122
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012667] [Browse all T6SS(s) in this replicon]
Location [Strand]132888..135941 [-]
ProductVgrG protein
NoteTssI
UniProt IDC3NY98
KEGG IDvcj:VCD_000122
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.30E-60, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 7.40E-25, Aligned region: 374..467
PG_binding_1 [PF01471], Evalue: 6.70E-09, Aligned region: 536..549
PG_binding_1 [PF01471], Evalue: 6.70E-09, Aligned region: 731..773
PG_binding_1 [PF01471], Evalue: 6.70E-09, Aligned region: 787..799
DUF2345 [PF10106], Evalue: 5.30E-05, Aligned region: 570..619
PG_binding_3 [PF09374], Evalue: 0.00087, Aligned region: 734..767
PG_binding_3 [PF09374], Evalue: 0.00087, Aligned region: 785..802
Protein Sequence: 1017 a.a.     [Download]
>gi|229605182|ref|YP_002875886.1| VgrG protein [Vibrio cholerae MJ-1236]
MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRCEPCYGFRYQVDLASALSNLTAEQFVDQTAHLTIL
RDGQVVQQINGIVRQLSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQQSVPEIISILLQEMGIEDYA
FALKRECAQREFCVQYRETDLQFLHRIAAEEGLVYSHLHEAQKHTLLFTDSSDSQPKLAKPVPYNALAGG
EINLPYVVDLQFKTTAQVSHTELKDYSFKKPAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFS
QIRLEYLRRDALLADAKSDEPLLLAGVRFDLQDHLDHAMNRDWLVVQANHQGTQPQALQEEGGSGATTYS
NQLKLIPAHITWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQ
EWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTETHQGQGYNEL
SFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRNQHLTVEGEVRSKIALDSSHE
VGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLKAGGSFVKVDAGGVHLVGPAINLNAGGSAGS
GSAYGGQLAAAPRMLAQAKPVAELVQPDIAASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPE
RILKSDLLKPSDELEKLAKRQASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQK
SYQPSHQTHPSYSIGAVDGIVGKGTLLALDEALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGN
GDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPATKEFNVVWQDIASRYPQEFREEQHQFIKRTH
YDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALNGQNMESMTDKDIIILVQDYKLVNTE
RLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVDIK
 
Nucleotide Sequence: 3054 bp     [Download]
>ref|NC_012667.1|:c135941-132888 VgrG protein [Vibrio cholerae MJ-1236]
ATGGCAAGGTTACAGTTTCAATTAAAGGTGGATGGCCTTGAGGATGAATCCCTCGTCGTACGCGGATTTG
AAGGGCAAGAGTCCTTGTCTGATTCTGTATGGCGCTGTGAACCCTGCTATGGTTTTCGCTATCAGGTTGA
TTTAGCCAGTGCGCTAAGCAACCTTACTGCTGAGCAATTTGTCGACCAAACCGCGCATTTAACCATTCTG
CGTGACGGGCAAGTGGTGCAGCAAATTAACGGTATCGTACGCCAATTGAGTAAAGGCGATACTGGGCATC
GGCACACGTTTTATTCTCTTACGTTAGTACCTGCGCTGGAGCGGCTTTCTTTACGCAGTAATAGCCGTAT
TTTCCAGCAGCAAAGCGTGCCGGAAATTATCTCTATTTTACTGCAAGAGATGGGGATTGAAGATTACGCC
TTTGCCCTTAAGCGTGAGTGTGCCCAGCGTGAGTTTTGTGTGCAGTACCGTGAAACGGATTTGCAGTTTT
TACACCGTATCGCCGCCGAAGAAGGCTTGGTATACAGTCACCTACATGAAGCGCAGAAACACACGCTACT
GTTTACCGATAGCTCGGACAGCCAACCGAAGTTAGCCAAGCCAGTACCTTATAATGCGCTGGCGGGTGGC
GAGATCAATCTCCCTTATGTGGTCGATCTGCAATTCAAGACCACCGCACAAGTCAGCCATACCGAGCTAA
AGGATTACAGCTTTAAAAAGCCAGCTTACGGATTTACTCAGCGCACGCAGGGTAAAGATATCGCTTATCA
GCAGCCAAATTATGAGCATTTTGATGCTCCGGGACGCTACAAAGACGATGCAAATGGCAAGGCCTTTAGC
CAAATTCGCTTAGAGTATTTACGTCGCGATGCTTTGCTTGCTGATGCGAAGAGTGACGAACCTTTGCTGT
TGGCGGGAGTGCGTTTTGACTTGCAAGATCACCTTGATCACGCAATGAATCGAGATTGGCTCGTGGTACA
AGCCAATCACCAAGGGACGCAGCCACAAGCGTTACAAGAAGAGGGTGGTTCAGGCGCTACCACTTACAGC
AATCAGCTAAAACTTATTCCCGCTCACATCACTTGGCGAGCAAGGCCTTGTGCTAAGCCGCAAGTGGATG
GTCCCATGATCGCCACCGTGGTTGGGCCACAAGGTGAAGAGATTTATTGCGATAACTTTGGTCGCGTGAA
AGTGCATTTCCCGTGGGATCGCTACTCAAGTAGCAACGAAAAAAGCTCTTGCTGGGTGCGAGTGGCACAA
GAATGGGCTGGTAGCCAATACGGTAGTATGGCGATTCCGCGAGTTGGCCATGAAGTGATTGTTTCGTTCC
TGAATGGCGATCCGGATCAACCCATCATCACAGGTCGTACGTATCATGCGACCAATACCGCGCCTTACGC
CTTGCCTGACCACAAAACCAAAACCGTGCTGCGCACTGAGACTCACCAAGGGCAAGGCTACAACGAACTG
AGTTTTGAGGATCAAGCGGGCAGCGAACAGATTTTGCTGCATGCACAAAAAGATTGGGATGCGTTGATTG
AGCATGATCACACCGAAGTGATTCGCCACGATCAACATCTCACTGTGGACAATGATCGCTTTACCCGCAT
TCAGCGCAACCAACATTTAACGGTTGAAGGTGAAGTCCGTAGCAAAATCGCACTCGATAGCAGCCATGAA
GTCGGCGCGTCACTACAACACAAAGTCGGGCAGCGCATTGCTGTCGAGGCGGGTAAAGAGATTTCACTCA
AAAGCGGCGCAAAAATCGTGGTTGAAGCCGGAGCGGAGTTAACCCTAAAAGCTGGGGGCAGTTTTGTAAA
AGTCGATGCTGGTGGCGTGCACTTAGTCGGTCCTGCCATTAACCTAAACGCGGGCGGCAGTGCAGGCAGC
GGTAGCGCTTATGGCGGGCAATTAGCGGCAGCACCGAGAATGTTAGCGCAAGCTAAACCAGTAGCAGAAT
TGGTTCAGCCGGATATTGCGGCCTCAATGCAATCAGGCGCGGCGCGTGTTATTGATGTGGCATCACTCCC
CACAATGATGCCGAGTTCAGCCAATAACACGGCAAATGATGAGCCTGTGGCCGAAGAGAAAACACCGGAG
CGAATTTTAAAATCCGATCTCCTCAAACCATCCGATGAGTTAGAGAAACTCGCCAAGCGACAAGCGAGTG
CTTATCGTCAAGGTAATCACAGCGATGAGGTTAAGTTACTACAAGAAGCGCTCATAAAATTGGGGTTTGA
TCTCGGGAAAGCAGGAGCTGATGGTGACTTTGGGAGCAAAACTAAAACCGCGATTGAGCAGTTCCAGAAA
AGCTATCAACCAAGCCACCAAACCCACCCGTCTTACAGCATTGGCGCTGTTGACGGTATTGTCGGCAAAG
GTACACTACTGGCACTAGACGAAGCCTTGATGGATGGGTGGGTGTATGAGAATAATATTTATCAAATATG
GCCTCTAGGTAAAACGTCAGAGAAATATGAGTCGGCAGGAAGAGGCCCAGGGGTTATATCAACAGGAAAT
GGAGATTATGGTGGGGCTTCATATGGTTGCTATCAAATGTCATCAAATCTTGGTGTGGTACAAAAATATA
TTCAGTCATCAAAATTCAAAGAATTCTTTAGTGGATTAAATCCCGCTACGAAAGAGTTTAATGTTGTTTG
GCAGGATATAGCTTCAAGATATCCTCAGGAATTCAGAGAAGAACAACACCAATTTATTAAGAGAACTCAT
TATGATATACAAATAGGACATCTTAGAGGGAAAGGACTTTTGTTTGAACATAATCGAGCTGCTGTACATG
ATTTGATCTGGTCTACTTCAGTACAGTTTGGTGGGAGAACTAATTTGATTTTCAATGCATTGAATGGACA
AAATATGGAAAGTATGACTGATAAGGACATCATTATTCTGGTACAAGATTACAAGCTTGTTAATACAGAA
AGGCTTTTTAAGTCTTCGCCATCATGGTGGAGTGATTTAAAAAAACGTGCGGTATCAGAGAAAAAAGCTT
TACTTGAACTAGAAATTGACGGTTTGGAGGTTGATATAAAATGA