SecReT6
Protein ID: 229605183
SecReT6 ID336
T6SS typei1
Gene symbol-
Locus tagVCD_000123
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012667] [Browse all T6SS(s) in this replicon]
Location [Strand]136194..137459 [-]
Producttype VI secretion-related protein VasL
NoteTssA
UniProt IDC3NY99
KEGG IDvcj:VCD_000123
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.20E-11, Aligned region: 47..101
Cytochrom_B562 [PF07361], Evalue: 0.0063, Aligned region: 120..136
Cytochrom_B562 [PF07361], Evalue: 0.0063, Aligned region: 172..185
Cytochrom_B562 [PF07361], Evalue: 0.0063, Aligned region: 325..397
Uds1 [PF15456], Evalue: 0.0075, Aligned region: 123..160
Uds1 [PF15456], Evalue: 0.0075, Aligned region: 296..340
Uds1 [PF15456], Evalue: 0.0075, Aligned region: 380..418
Protein Sequence: 421 a.a.     [Download]
>gi|229605183|ref|YP_002875887.1| type VI secretion-related protein VasL [Vibrio cholerae MJ-1236]
MMSNVIFIDNVCYRLTNDSEEIRGLEPYAKVREEINRRFNPIAGGTDWAVVKEYCEQLACNQGMDFLICG
YYAVACLKTQGLAGYATGMELMSASLANQGECDVKSAKVRKEILDWVNARVVQELKALKPTYESLRDLYR
AERHCERLHQLFEQQQTEYKVDFEGVGFALFEHIDRIETQYHSLLKKQEKAQPPKLKFWQRGYALFTLGV
LGVALGMVGGYWGWPWFYTTPYAAPQRITTLNEASQTQALLNDSSTSERARWQHDLIPLYRDTLQQNLTI
SFSEPKRHAITQLNLLRTLYPENEQVNALSQEFALQQQQALEQTALFVAKFSEIRTKMANISLLAKRGKW
AELEKQTKSLEEFAVSLSPIYGRVDYVQGLLEQGDVTNAQKEFAILKQRLDSLSWKIAELEQRIGDAALL
Q
 
Nucleotide Sequence: 1266 bp     [Download]
>ref|NC_012667.1|:c137459-136194 type VI secretion-related protein VasL [Vibrio cholerae MJ-1236]
GTGATGTCCAATGTGATTTTTATTGATAACGTTTGCTACCGATTAACCAATGATTCTGAGGAGATTCGCG
GATTAGAGCCCTATGCGAAGGTTCGTGAGGAGATAAACCGCCGCTTCAATCCGATTGCTGGGGGCACGGA
TTGGGCAGTGGTAAAAGAGTACTGTGAACAACTGGCCTGTAACCAAGGAATGGATTTTCTGATCTGCGGT
TACTATGCGGTAGCCTGCCTGAAAACTCAGGGGTTAGCGGGGTATGCCACCGGTATGGAGCTGATGAGTG
CAAGCCTTGCCAACCAAGGTGAGTGTGATGTGAAAAGCGCCAAAGTGCGCAAAGAGATCCTTGATTGGGT
CAATGCACGTGTGGTGCAGGAACTGAAAGCACTTAAGCCAACTTATGAGTCGCTGCGAGATCTGTATCGG
GCTGAGCGCCATTGCGAGCGGTTACATCAGCTGTTTGAACAGCAACAAACCGAATACAAAGTAGACTTTG
AAGGGGTCGGGTTTGCTCTGTTTGAACACATAGACAGAATTGAAACCCAATACCACAGCTTATTGAAAAA
GCAGGAGAAGGCTCAGCCACCTAAGCTTAAGTTTTGGCAGCGCGGTTACGCGTTGTTCACTCTAGGTGTA
CTCGGGGTTGCACTGGGAATGGTGGGGGGCTACTGGGGGTGGCCTTGGTTTTATACCACGCCTTATGCCG
CGCCACAGCGCATCACTACGTTGAATGAGGCCTCTCAAACTCAAGCACTGCTCAACGACTCTTCCACAAG
TGAGCGTGCGCGTTGGCAACATGATCTGATCCCGCTGTATCGCGATACTTTGCAGCAGAATTTAACCATC
TCGTTTAGTGAACCTAAGCGACATGCCATCACTCAGCTGAATCTATTGCGCACTCTTTATCCTGAAAACG
AGCAAGTGAATGCACTGAGTCAAGAGTTTGCCCTTCAGCAGCAACAAGCGTTGGAGCAAACCGCGCTGTT
CGTGGCTAAGTTCAGCGAAATTCGCACCAAAATGGCCAATATCTCGTTATTGGCTAAGCGAGGGAAATGG
GCTGAGTTAGAAAAGCAGACCAAATCATTAGAAGAGTTCGCGGTCAGCCTATCACCGATTTATGGTCGAG
TTGACTATGTGCAAGGCCTCCTTGAACAGGGCGATGTCACAAATGCCCAGAAAGAGTTTGCGATCCTCAA
ACAAAGGCTAGATAGCCTAAGTTGGAAAATTGCCGAGCTTGAGCAGCGTATCGGCGATGCGGCTTTGTTG
CAGTGA