SecReT6
Protein ID: 229605185
SecReT6 ID336
T6SS typei1
Gene symbol-
Locus tagVCD_000125
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012667] [Browse all T6SS(s) in this replicon]
Location [Strand]141068..142477 [-]
Producthypothetical protein
NoteTssA
UniProt IDC3NYA1
KEGG IDvcj:VCD_000125
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-16, Aligned region: 49..109
PPDK_N [PF01326], Evalue: 0.0077, Aligned region: 81..199
Protein Sequence: 469 a.a.     [Download]
>gi|229605185|ref|YP_002875889.1| hypothetical protein VCD_000125 [Vibrio cholerae MJ-1236]
MEMTEYRQCVAKPISSSNPVGERLVDHPLFDFIEDQMMKVGSLSHASVQWDEVEHSTLKLLGEQSKDIKL
LVYLLQCLHNQVTPTRLITSFAVMSEFLNQYWNDSYPAPGPRGNLPRRKFFSQMAQRFTTVIEKFDFHHL
DEADRQALQAAVEEWQQAVEKQGLSSELVESVVVRITAEIKRAEQRQQVTAQSSAERETPSAATPSPAAS
MVVDHSSDKAAKQTLLKVADFLAEQEFGIALSIRLRRFAVWGSITSLPDHKPDGETLLRGMQADRVKDYQ
DQLRHPDLALWRKVEQSLTMAPYWFEGQWMSYTIAQQLGKSDWCQAIAEETQQFLRRLPSLLELKFKGGE
PFVSDSVKEWLASVGQSQGAAGQSVGGDWQEKRKEAFQLAKEGGIAVALSMLNDGLVSAVEPRDKFYWRL
LSADLLRANHLDAMAGEQYQTLLNQVTTLSVPEWEPSLVEQIQRYTTSE
 
Nucleotide Sequence: 1410 bp     [Download]
>ref|NC_012667.1|:c142477-141068 hypothetical protein VCD_000125 [Vibrio cholerae MJ-1236]
ATGGAAATGACTGAATACCGTCAGTGTGTGGCCAAACCGATCAGCAGTAGCAATCCTGTCGGAGAGCGGC
TAGTCGATCACCCACTGTTTGATTTTATTGAGGATCAGATGATGAAAGTGGGCTCTCTCTCTCACGCTTC
AGTGCAGTGGGATGAAGTGGAGCACAGCACTCTCAAACTGCTTGGTGAACAGAGTAAAGACATCAAGCTT
TTGGTTTACCTGCTGCAGTGTCTGCATAACCAAGTTACCCCGACGCGCCTTATTACCTCGTTTGCGGTGA
TGAGTGAGTTCCTCAATCAATATTGGAACGACAGTTATCCAGCGCCGGGCCCACGTGGCAATCTGCCGCG
ACGTAAATTTTTCAGCCAGATGGCGCAACGTTTTACCACGGTGATCGAAAAGTTCGATTTTCATCATCTG
GATGAAGCGGATCGCCAAGCGCTACAAGCGGCGGTTGAAGAGTGGCAACAAGCCGTTGAGAAACAAGGGC
TCTCTTCTGAGTTGGTGGAGTCTGTGGTGGTGCGAATTACCGCGGAGATCAAACGCGCAGAGCAGCGCCA
GCAAGTGACGGCGCAAAGCAGCGCGGAGCGTGAAACACCAAGTGCTGCAACGCCTTCTCCTGCGGCGAGT
ATGGTGGTGGATCATTCGAGTGACAAAGCAGCGAAACAAACCCTACTCAAAGTGGCAGATTTTCTTGCCG
AACAAGAGTTTGGTATCGCTCTTTCGATTCGTCTGCGCCGCTTTGCGGTGTGGGGCAGCATTACCTCATT
GCCCGATCATAAACCCGATGGTGAAACACTGCTGCGTGGAATGCAGGCGGATCGCGTCAAGGATTACCAA
GATCAACTTCGTCACCCCGATTTAGCCTTGTGGCGCAAAGTCGAACAGAGCTTAACCATGGCTCCTTATT
GGTTTGAAGGACAGTGGATGAGTTACACCATTGCCCAGCAACTCGGCAAAAGTGATTGGTGTCAGGCGAT
TGCCGAAGAAACACAACAGTTTTTACGTCGTTTGCCTTCGCTGCTTGAGCTCAAATTCAAAGGCGGAGAG
CCGTTTGTCAGCGATTCGGTCAAAGAGTGGCTGGCGAGCGTAGGTCAGAGCCAAGGTGCTGCGGGGCAAT
CGGTCGGCGGAGATTGGCAAGAGAAGCGTAAAGAGGCGTTTCAACTGGCTAAAGAAGGTGGAATCGCGGT
GGCACTTTCCATGCTCAATGATGGCTTGGTCAGTGCGGTGGAGCCGCGAGACAAATTTTACTGGCGATTG
CTATCGGCAGATCTGCTGCGGGCAAATCATCTCGATGCGATGGCTGGTGAACAGTATCAAACTCTGCTCA
ATCAGGTAACGACGCTGTCTGTTCCTGAGTGGGAACCGAGTTTAGTGGAACAAATTCAAAGATATACAAC
GTCAGAGTAA