SecReT6
Protein ID: 229605186
SecReT6 ID336
T6SS typei1
Gene symbol-
Locus tagVCD_000126
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012667] [Browse all T6SS(s) in this replicon]
Location [Strand]142487..143170 [-]
Producttype VI secretion protein VasI
NoteVCA0118
UniProt IDC3NYA2
KEGG IDvcj:VCD_000126
PDB IDNA
Domain hit(s) vs Pfam DUF3121 [PF11319], Evalue: 5.30E-59, Aligned region: 41..221
Protein Sequence: 227 a.a.     [Download]
>gi|229605186|ref|YP_002875890.1| type VI secretion protein VasI [Vibrio cholerae MJ-1236]
MPEIGDQNPMRITVLVVSLILGCAGSAHVLAASQDAGSQVEQAELCREIPARLERLACFDRVFATPLEQV
AIAPSNPYPAEWQRAMAALSESQSEAGWVLGTQGEGRGSSAWIALPAQNRSSGETSPPVLLLSCINNLSR
IELALPKEVADARIQVSIRHETQFWRSDDHGVLFSSARGMPAIEMMKLAASESRLLLRSNAPFADGLQFD
TRGVNEALDALRERCGW
 
Nucleotide Sequence: 684 bp     [Download]
>ref|NC_012667.1|:c143170-142487 type VI secretion protein VasI [Vibrio cholerae MJ-1236]
GTGCCTGAAATTGGAGATCAAAACCCCATGAGAATTACCGTTTTAGTGGTCAGTTTGATCTTGGGTTGCG
CGGGCTCTGCGCATGTTTTAGCAGCATCGCAAGATGCGGGCTCACAGGTTGAGCAAGCTGAGCTGTGCCG
CGAAATTCCTGCGCGTTTAGAGCGTTTGGCTTGTTTTGACCGTGTCTTTGCCACGCCCCTTGAGCAAGTG
GCTATCGCACCGTCCAATCCTTATCCCGCAGAGTGGCAACGCGCCATGGCGGCATTGTCTGAGTCGCAGT
CCGAAGCGGGTTGGGTATTAGGTACGCAAGGTGAAGGGCGGGGCAGCAGCGCTTGGATTGCTTTGCCTGC
GCAAAATCGCAGCTCAGGGGAAACATCTCCGCCAGTGCTCTTGCTCAGTTGCATTAATAACCTGAGCCGC
ATTGAGCTGGCTTTACCGAAAGAAGTGGCTGATGCACGGATTCAAGTCTCTATCCGACACGAGACACAGT
TCTGGCGCAGTGACGATCACGGCGTACTGTTTTCCTCGGCTCGCGGCATGCCTGCGATCGAAATGATGAA
ATTGGCCGCCAGTGAGTCTCGCCTGTTGCTGCGTTCTAATGCGCCCTTTGCTGACGGGTTACAGTTTGAT
ACTCGAGGTGTCAATGAAGCCCTTGATGCTTTGCGCGAACGCTGTGGTTGGTAA