SecReT6
Protein ID: 229605190
SecReT6 ID336
T6SS typei1
Gene symbol-
Locus tagVCD_000130
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012667] [Browse all T6SS(s) in this replicon]
Location [Strand]148146..149480 [-]
Producthypothetical protein
NoteTssK
UniProt IDC3NYA6
KEGG IDvcj:VCD_000130
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.80E-161, Aligned region: 19..443
GMP_synt_C [PF00958], Evalue: 0.00014, Aligned region: 63..139
GMP_synt_C [PF00958], Evalue: 0.00014, Aligned region: 302..374
Protein Sequence: 444 a.a.     [Download]
>gi|229605190|ref|YP_002875894.1| hypothetical protein VCD_000130 [Vibrio cholerae MJ-1236]
MFARNRVIWNEGLFIKPQHFQQQQRYTEYCLDERLSTVSRYLYGISELSLNPEYLSFGRIAIERAVGVMP
DGTTFRIPQEDHLPDALEVTDASLANQIVYLAVPLRSESLMEINWPEERGTGRYVSRRLEVRDVHSVQGD
TTTIDVSPVRLQLMLEREDRSAYASIAIGRILEKRPDGSVVLDPDFIPCHLNVVGISALHRFINEMSGLM
RERAKNIAQRISSPAQGGVADVSDFMLLQALNRLQPQMKHLAELRSLHPERLFECLSCVCGELATFTDES
RLPPSLPSYNHDSPSHSFQPLIRSLRQSLSVVLEPRAVSIQLDKRKYGLMVAPIHDPQLMESAEFIIAVK
ARMPLDELRRLFTQQTKVASVEKIRELISLQLPGIPLTPLPVAPRQLPYHAGYTYYQLDKTSAAWAMLTH
SSGFAFHVAAAFDDLELQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>ref|NC_012667.1|:c149480-148146 hypothetical protein VCD_000130 [Vibrio cholerae MJ-1236]
ATGTTTGCGCGTAACCGAGTGATCTGGAATGAAGGGCTATTTATTAAGCCGCAACATTTCCAGCAACAGC
AGAGATATACGGAGTACTGCCTAGACGAGCGCCTGAGCACCGTGAGCCGTTACTTGTATGGGATTTCCGA
GTTGTCGCTCAACCCGGAATACCTCTCGTTTGGCCGTATTGCGATTGAGCGTGCGGTCGGCGTGATGCCC
GATGGCACCACCTTTCGTATTCCTCAAGAAGATCATCTTCCCGATGCGCTCGAAGTGACCGATGCGTCAT
TGGCAAACCAGATTGTCTACTTAGCCGTACCGCTACGTAGTGAGTCGCTGATGGAGATTAACTGGCCAGA
AGAGCGTGGTACGGGGCGCTATGTCAGCCGTCGTCTCGAAGTGCGTGATGTCCATAGCGTGCAGGGTGAT
ACCACGACGATTGATGTTTCCCCTGTGCGTTTGCAACTCATGCTTGAGCGAGAGGATCGCAGTGCGTATG
CCTCAATTGCTATTGGCCGTATTTTAGAAAAACGTCCTGATGGCAGCGTGGTGCTCGATCCGGATTTCAT
CCCTTGTCACTTGAATGTAGTGGGCATCTCTGCGCTGCACCGCTTTATTAATGAGATGTCAGGCCTGATG
CGTGAGCGAGCGAAAAATATTGCTCAGCGCATCAGCTCTCCAGCACAAGGTGGGGTTGCTGATGTTTCGG
ACTTTATGCTGCTGCAAGCTTTAAACCGTCTGCAACCACAAATGAAGCATTTGGCAGAGCTGCGCAGCTT
ACACCCAGAGCGTCTGTTTGAATGTCTCTCGTGTGTGTGTGGTGAGCTGGCTACCTTTACTGACGAAAGT
CGTCTGCCGCCCAGTTTGCCAAGCTATAACCATGATTCACCCAGCCACTCTTTCCAGCCGCTGATCCGCA
GCTTGCGTCAGAGCTTGAGCGTGGTGCTAGAGCCGCGTGCCGTCTCTATCCAACTGGATAAACGTAAGTA
CGGTTTGATGGTTGCGCCAATCCATGATCCGCAACTGATGGAGAGTGCAGAGTTTATCATCGCGGTTAAA
GCTCGCATGCCGTTGGATGAGCTACGCCGTCTGTTTACTCAGCAAACCAAAGTGGCATCGGTTGAGAAAA
TTCGTGAACTCATCTCACTGCAACTGCCGGGTATTCCATTGACGCCATTACCCGTCGCACCGCGCCAATT
GCCTTACCACGCTGGCTACACCTACTACCAACTGGATAAAACCAGCGCTGCATGGGCGATGTTGACTCAT
TCCAGCGGTTTTGCGTTCCACGTTGCTGCAGCTTTTGACGATCTTGAGCTGCAATTCTGGGCTATCAGGA
GCTAA