SecReT6
Protein ID: 229605191
SecReT6 ID336
T6SS typei1
Gene symbol-
Locus tagVCD_000131
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012667] [Browse all T6SS(s) in this replicon]
Location [Strand]149487..149963 [-]
Producttype VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDC3NYA7
KEGG IDvcj:VCD_000131
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.80E-38, Aligned region: 12..148
Protein Sequence: 158 a.a.     [Download]
>gi|229605191|ref|YP_002875895.1| type VI secretion lipoprotein/VasD [Vibrio cholerae MJ-1236]
MNKVLWMLFALTVLTACSSSDKYEPAKEPTKVTFSLVSDEGVNPNIWGEASPIEIQVFELKDDSMFMSSD
YDQIKTDYKKALRSNFVKNYDYVLTPGQFKFVNAFEVDEETNYIGVMAHFAEPELSEWKKAVKVINKGRE
YHLLMLFKDYDVKLDRVE
 
Nucleotide Sequence: 477 bp     [Download]
>ref|NC_012667.1|:c149963-149487 type VI secretion lipoprotein/VasD [Vibrio cholerae MJ-1236]
GTGAACAAAGTGCTGTGGATGCTGTTTGCCTTGACGGTACTGACCGCGTGCAGTTCGTCGGATAAGTACG
AGCCTGCGAAAGAGCCGACCAAGGTGACTTTTAGCTTAGTCAGCGATGAAGGGGTGAACCCGAACATCTG
GGGTGAAGCGTCACCGATAGAAATTCAAGTTTTTGAGCTAAAGGATGACTCGATGTTTATGTCGTCCGAC
TACGACCAGATCAAAACCGATTATAAAAAAGCGCTGCGCAGTAACTTTGTTAAAAACTACGACTATGTAC
TGACTCCAGGGCAGTTCAAATTCGTCAACGCTTTCGAAGTCGATGAGGAGACCAACTACATCGGCGTGAT
GGCTCATTTTGCCGAGCCTGAACTCAGCGAATGGAAGAAAGCGGTCAAGGTGATCAATAAAGGGCGAGAG
TATCACTTGCTGATGCTGTTTAAAGACTACGATGTGAAATTGGATAGGGTGGAATAA