SecReT6
Protein ID: 229605193
SecReT6 ID336
T6SS typei1
Gene symbol-
Locus tagVCD_000133
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012667] [Browse all T6SS(s) in this replicon]
Location [Strand]151456..152472 [-]
Producthypothetical protein
NoteTssG
UniProt IDC3NYA9
KEGG IDvcj:VCD_000133
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-93, Aligned region: 27..325
Protein Sequence: 338 a.a.     [Download]
>gi|229605193|ref|YP_002875897.1| hypothetical protein VCD_000133 [Vibrio cholerae MJ-1236]
MGHTERNAAVDLNSDPAQASPLSLPGNVREYNFYQLVELLQKLADINPESEEWERDCRLVFSANPSLGFS
PSDVMALEARDDERWVMLTNFFGLSGAQSPLPGFILEQLVTEEPGGYKQPFLDFFNNRLINLVYRVWRKY
RYYVRFQPGAQDVFSAQLFALVGLGDPDLRGETPINWCKMLAYAGTLAGRSRSPQVVAGIIAHCFDLPDV
SIRQWVRRRVSIDRSQQLALGKQNARLGMDTVIGESVIDCSGKFIICIKRLSRSRFADFLPSGKEYQPLC
KLVEFILREQMAYDLELAMDEREAPLFCLDTRQNIALGWTSFLGQDAANKHVLIQVRQ
 
Nucleotide Sequence: 1017 bp     [Download]
>ref|NC_012667.1|:c152472-151456 hypothetical protein VCD_000133 [Vibrio cholerae MJ-1236]
ATGGGGCACACAGAGCGGAATGCAGCCGTTGATCTGAATTCAGATCCAGCGCAAGCCTCTCCGTTGAGCT
TGCCGGGCAATGTACGGGAATACAACTTCTACCAACTGGTTGAGCTGTTGCAAAAACTGGCTGATATCAA
TCCCGAATCGGAAGAGTGGGAGCGCGATTGCCGCTTGGTGTTCAGTGCTAACCCGAGCCTTGGATTTTCG
CCCAGTGATGTGATGGCGCTTGAAGCGCGTGACGATGAGCGTTGGGTTATGTTGACCAACTTTTTTGGCC
TTTCCGGTGCACAGTCACCTCTGCCGGGGTTCATCCTTGAGCAATTGGTGACGGAAGAGCCTGGGGGATA
TAAGCAGCCGTTTCTCGATTTTTTCAATAACCGATTGATTAATTTGGTTTATCGCGTTTGGCGTAAATAC
CGTTACTACGTACGTTTTCAGCCCGGTGCGCAGGATGTGTTCTCTGCACAGCTGTTTGCGCTGGTGGGGT
TGGGCGATCCTGACCTTCGCGGTGAAACGCCGATCAACTGGTGCAAAATGCTGGCTTACGCGGGCACGCT
GGCCGGACGTAGCCGTTCGCCACAAGTTGTGGCCGGCATTATTGCTCACTGTTTTGATTTACCGGATGTC
TCCATTCGCCAGTGGGTCAGACGTCGGGTATCGATTGATCGGAGTCAGCAACTGGCGCTGGGCAAGCAGA
ATGCGCGGTTGGGGATGGACACGGTGATTGGCGAGTCCGTTATTGATTGCAGTGGAAAATTTATTATCTG
TATCAAACGGTTATCTCGCAGTCGTTTTGCTGATTTTTTGCCCTCCGGTAAAGAGTATCAGCCACTTTGC
AAGCTGGTGGAGTTTATTTTGCGCGAACAGATGGCGTATGACCTCGAGCTGGCGATGGATGAACGAGAAG
CGCCGCTGTTTTGTCTGGATACTAGACAGAATATCGCCCTCGGCTGGACTTCGTTTCTTGGCCAAGATGC
AGCCAATAAACATGTGTTAATTCAAGTAAGGCAATAA