SecReT6
Protein ID: 229605194
SecReT6 ID336
T6SS typei1
Gene symbol-
Locus tagVCD_000134
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012667] [Browse all T6SS(s) in this replicon]
Location [Strand]152436..154205 [-]
Productprotein ImpG/VasA
NoteTssF
UniProt IDC3NYB0
KEGG IDvcj:VCD_000134
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-209, Aligned region: 5..589
Protein Sequence: 589 a.a.     [Download]
>gi|229605194|ref|YP_002875898.1| protein ImpG/VasA [Vibrio cholerae MJ-1236]
MTQDKYFREELAFLKEQGKEFTEIHPQLSRFLHGRTTDPDVERLLEGFAFLTARLREKVEDEFPELTHSI
INMLWPNYLRPIPSMSVVAFEPDKSVSEKQVIPRNTQLDSKPVFGTACHFNTCRDVALYPMQCQGVHAEH
TREATTIQISLRMLGDMTVGDAKLDTVRFYLGGDKYSSQTLYLWLHHYLQKMTIEVQGVEFALPADAFST
VGFSSDQALLPYPKNVYDGYRILQEYLSFPEAFHFFDVKGFAKALPKAVSGDFTLRIHFSKTLPADTRVR
QDNFQLYCTPVINLFEHDADPIDLTGRRSEYRIVPSSRYPAHYEIFSVDQVVGWQDTQSEGKRIRGEKRI
YSSFESFQHEVERVRHRQALYYRTRVKESIRGDGFDSFISFVRGDETLSMGVDEAVSIKLTCTNRLLPLE
LGVGDICVATDSSPPFATFKNITVPSQSLRPVLDGSLLWTLISNLSLNYLSLLSKDALSCVLRAYDFRAL
VDRQAERVARMRLDGIVKIESKPVDKILRGLPVRGLQSTLYVDQAGFGSEGDLFLFGTVLSHFFALYASI
NSFHELVVVNISNQEKYSWGTQSGMQPLI
 
Nucleotide Sequence: 1770 bp     [Download]
>ref|NC_012667.1|:c154205-152436 protein ImpG/VasA [Vibrio cholerae MJ-1236]
ATGACGCAAGACAAGTATTTCAGGGAAGAGCTCGCTTTTTTAAAAGAGCAGGGGAAAGAATTTACCGAAA
TTCACCCTCAGCTTTCGCGTTTTCTTCATGGCCGTACGACCGATCCTGACGTTGAGCGTCTTCTGGAAGG
TTTTGCATTTCTTACCGCGCGTTTGCGCGAAAAGGTGGAGGATGAGTTCCCTGAACTTACTCACTCCATC
ATTAACATGCTGTGGCCAAATTATCTGCGCCCTATCCCGAGCATGAGTGTGGTGGCGTTTGAACCTGACA
AAAGTGTCAGCGAGAAGCAAGTCATCCCACGTAATACCCAATTGGATAGCAAGCCAGTCTTTGGCACGGC
GTGTCATTTCAACACTTGCCGTGATGTCGCGCTGTATCCGATGCAGTGTCAAGGTGTTCATGCCGAGCAC
ACACGTGAAGCCACGACCATTCAGATCTCGTTGCGCATGCTGGGCGATATGACAGTAGGCGACGCTAAGC
TCGATACCGTACGTTTTTACTTAGGTGGTGATAAATACAGCTCGCAGACTCTCTATCTTTGGTTACACCA
TTATCTACAAAAAATGACCATTGAAGTGCAAGGTGTCGAGTTCGCACTGCCTGCTGATGCGTTTTCAACC
GTTGGTTTCTCAAGTGACCAAGCTTTGCTGCCTTATCCAAAGAATGTCTATGACGGTTATCGTATTTTGC
AAGAGTACCTGTCGTTTCCTGAAGCCTTTCACTTCTTTGATGTAAAAGGTTTTGCCAAAGCTTTACCGAA
AGCGGTCAGCGGTGATTTCACCTTACGCATCCATTTTTCGAAAACATTGCCTGCTGATACGCGAGTGCGT
CAGGACAATTTTCAACTCTATTGCACACCGGTCATCAATCTGTTTGAGCATGATGCCGATCCGATCGATT
TGACTGGGCGTCGTTCAGAGTATCGAATCGTCCCGTCCAGTCGCTATCCTGCCCACTATGAAATTTTCAG
CGTGGATCAAGTGGTTGGTTGGCAAGATACCCAGTCAGAAGGCAAACGGATCCGCGGAGAGAAGCGTATC
TACTCTTCTTTTGAAAGCTTCCAACATGAAGTGGAACGGGTTCGTCATCGTCAAGCGCTTTACTATCGCA
CACGAGTCAAAGAGAGCATCCGGGGGGATGGTTTTGATTCATTTATCTCTTTTGTGCGCGGTGATGAAAC
CTTATCAATGGGCGTAGATGAAGCCGTCTCAATCAAACTCACCTGCACCAATCGCTTGCTGCCATTGGAA
CTTGGGGTGGGGGATATTTGTGTGGCGACCGACAGCTCACCCCCTTTTGCCACATTTAAAAATATTACGG
TGCCTTCGCAGTCACTGCGCCCGGTTCTCGATGGCAGCTTACTGTGGACGCTGATCTCGAATCTATCGCT
GAACTACCTATCACTGCTTTCAAAAGATGCACTGAGCTGTGTGCTACGCGCTTACGATTTTCGCGCCTTG
GTCGATAGGCAAGCTGAACGTGTCGCACGGATGCGCCTTGATGGCATAGTCAAAATAGAATCTAAACCGG
TTGATAAAATCCTACGTGGTTTGCCTGTGCGTGGTTTGCAATCGACTTTGTATGTCGATCAAGCGGGATT
TGGCTCGGAAGGTGATTTGTTCCTGTTTGGTACGGTACTCAGTCATTTCTTTGCACTTTACGCCAGCATC
AACTCATTTCACGAATTAGTCGTGGTTAACATCAGCAATCAAGAGAAGTACTCATGGGGCACACAGAGCG
GAATGCAGCCGTTGATCTGA