SecReT6
Protein ID: 237806969
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0193
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]212136..213677 [+]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDC4L824
KEGG IDtau:Tola_0193
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.60E-18, Aligned region: 53..112
Protein Sequence: 513 a.a.     [Download]
>gi|237806969|ref|YP_002891409.1| type VI secretion-associated protein [Tolumonas auensis DSM 9187]
MKLNDTEMVNAIIAPVIGHAFPQGEDVRYDSDFEMVEAELAKLTSVYKDHKTDWKLVLQLSYELLTTRSK
DLRIVCWYAYAQLKVNGLVRLPAVLFMLQKVIEQYWEQCFPVKIRARLAALIWLFDRIDYNENKYAENLS
SDELNLLILSLESCDEILNGKFDGEISFLQPKLQLLRDIRRRQNMSKIEPVLANPVSPNHTSVIDVLVPV
LSTITEDNDSIRIARYIQEQSRLLTIWFLSKDLADPRAYLLTRSSAWLQVVSAPLADAQGLTKLKPLTAN
KLQEYQQKLSAKEFAVLIPELEVSLSKAPFWLDGHHWCAQALDGLGHHQMANHLRDYLCSFLSKHPSLLE
LSFDDGSPFASETTKLWLSTASSEQMTNCAVFNNSADEQQPWLMALAMAQENINHDISCLKQEIRSLQTL
ANTATSGRDKTMWLLALAKLCQQYQRHDLAVFILEDIHQYIYQFRLNQWEPLLEKNVLQQLLFSLEKVNA
KQHQEKIKEIKTNLYRMDISIAF
 
Nucleotide Sequence: 1542 bp     [Download]
>ref|NC_012691.1|:212136-213677 type VI secretion-associated protein [Tolumonas auensis DSM 9187]
ATGAAATTAAATGATACTGAAATGGTAAATGCCATCATTGCACCTGTCATCGGTCACGCTTTTCCACAGG
GTGAGGATGTTCGCTATGATTCTGATTTTGAAATGGTTGAAGCCGAACTAGCGAAACTGACTAGTGTCTA
TAAAGATCACAAAACTGATTGGAAATTAGTTCTGCAATTAAGTTATGAATTGCTCACAACCCGTAGTAAA
GATCTGCGCATTGTCTGCTGGTATGCATATGCACAACTGAAAGTTAACGGGTTGGTTCGGTTGCCTGCTG
TGCTTTTTATGTTGCAAAAAGTAATTGAGCAATACTGGGAACAATGTTTCCCTGTAAAAATCAGAGCTCG
TTTAGCCGCATTAATCTGGTTGTTTGACCGCATTGATTACAATGAAAATAAATACGCAGAAAATTTATCC
AGCGATGAACTGAACTTACTTATTTTATCTCTGGAATCATGCGATGAAATACTGAACGGAAAATTTGATG
GCGAGATTTCTTTTTTACAGCCCAAGCTTCAGCTGTTACGTGATATTCGGCGACGGCAGAACATGAGTAA
AATTGAACCGGTTTTAGCTAATCCGGTATCACCAAATCATACTTCGGTGATCGATGTATTGGTTCCTGTT
CTGAGTACGATAACGGAAGATAACGATAGTATTCGTATTGCCCGTTATATTCAGGAACAATCCCGTTTAC
TTACGATTTGGTTTCTTAGTAAAGATTTGGCAGATCCCCGTGCTTACTTACTAACACGTAGCAGCGCATG
GTTACAGGTGGTTTCTGCTCCTTTAGCTGATGCGCAAGGTCTTACGAAGTTAAAACCATTAACTGCTAAT
AAGTTGCAGGAATATCAACAAAAATTGTCAGCAAAAGAGTTTGCTGTGTTGATTCCGGAGCTGGAAGTTA
GTTTATCAAAAGCACCCTTCTGGCTGGATGGTCATCACTGGTGTGCTCAGGCGTTGGACGGGTTAGGTCA
TCATCAGATGGCTAATCACTTACGGGATTATTTATGTTCCTTTCTAAGCAAACATCCCTCATTGCTTGAA
TTATCTTTTGATGACGGCAGCCCCTTTGCCTCAGAGACAACTAAACTATGGCTCTCAACTGCATCATCAG
AGCAGATGACTAATTGTGCAGTCTTCAATAATTCAGCGGATGAACAGCAGCCCTGGTTAATGGCATTAGC
TATGGCTCAGGAAAATATTAATCATGATATTTCATGTTTAAAACAAGAAATACGTAGTTTACAGACTCTG
GCTAACACTGCGACATCTGGACGAGATAAAACGATGTGGTTATTGGCATTGGCTAAACTCTGTCAACAAT
ATCAGCGTCATGATCTGGCAGTTTTTATTCTGGAAGATATACATCAGTATATTTATCAATTTCGGCTTAA
TCAGTGGGAACCATTATTAGAGAAAAACGTATTACAGCAACTACTGTTTAGTCTTGAAAAGGTAAATGCT
AAACAACATCAGGAAAAAATAAAAGAAATAAAAACAAATCTTTATCGAATGGATATTTCCATCGCGTTTT
GA