SecReT6
Protein ID: 237806970
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0194
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]213691..214185 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDC4L825
KEGG IDtau:Tola_0194
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.20E-51, Aligned region: 6..160
Protein Sequence: 164 a.a.     [Download]
>gi|237806970|ref|YP_002891410.1| type VI secretion protein [Tolumonas auensis DSM 9187]
MSGKEGSVAPKERINVTFKPSTGEGMEELELPLKLMMIGDYTLTKDDRKLEDRKAININKNNFNEVLENQ
NIGLDLQVPNRLSNHDVNEEIALSLRFKTLKDFDPANLVQQVPEMKALMELRDALVALKGPLGNVPSFRK
AIEEVLTNQDAREKVLAELGMVEK
 
Nucleotide Sequence: 495 bp     [Download]
>ref|NC_012691.1|:213691-214185 type VI secretion protein [Tolumonas auensis DSM 9187]
ATGTCGGGAAAAGAAGGCTCTGTTGCACCGAAAGAGCGGATTAATGTCACCTTCAAACCATCTACTGGTG
AAGGGATGGAAGAGCTTGAGTTGCCACTTAAGTTAATGATGATTGGTGATTACACTCTGACAAAAGATGA
TCGCAAACTTGAAGATCGTAAAGCCATTAATATCAATAAGAACAATTTCAATGAGGTACTGGAAAATCAG
AATATTGGTTTAGATCTGCAAGTTCCGAATCGTCTGAGTAACCATGATGTGAATGAAGAAATAGCACTTA
GTTTGCGTTTCAAAACATTAAAAGATTTTGACCCGGCGAATCTGGTACAGCAAGTACCAGAAATGAAAGC
TCTAATGGAACTCCGTGATGCCTTAGTTGCACTGAAAGGGCCGTTAGGCAACGTACCATCTTTCCGTAAA
GCAATTGAAGAAGTTTTGACCAACCAGGATGCCAGAGAAAAAGTGTTGGCTGAGTTGGGAATGGTTGAAA
AATAA