SecReT6
Protein ID: 237806971
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0195
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]214204..215679 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDC4L826
KEGG IDtau:Tola_0195
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.50E-191, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|237806971|ref|YP_002891411.1| type VI secretion protein EvpB [Tolumonas auensis DSM 9187]
MKQRLGEQVTATLEPVNILDRIIAETKLTPQDEAYDIAKRGVSAFIEELLKSKSSAEPVKKALVDKMIAA
IDEKLSRQVDEILHNTKFQQMESAWCGLKMVVDRTDFDQNIKLEILNVSKEDLLDDFEDASDITHSGLYK
HIYTSEYGQFGGQPVGAIIANYAFGPSAPDVKILQYASSVAAMSHAPFISAAGPKFFGLESYEGLPNIKD
LNDHFDGPQYTKWQSFRETEDSRYVGLTLPRFLLRQPYSPEDNPVKTFVYQEDVSATHEHYLWGNSAYAF
ATRLTESFAKYRWCPNIIGPRSGGAVNDLPLHHFESMGEIETKIPTEVLVSDRREYQLAEQGFISLTMRK
GSDNAAFFSANSAQKPKFFGNSEEGKKAELNYKLGTQLPYMFVICRLAHYIKVLQREQIGSWKERTQLET
ELNKWLRQYIADQENPPAEVRSRRPLRAAQITVEDVDGEPGWYRVGIAVRPHFKFMGADFTLSLVGKLDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>ref|NC_012691.1|:214204-215679 type VI secretion protein EvpB [Tolumonas auensis DSM 9187]
ATGAAACAGAGATTAGGTGAGCAGGTTACAGCAACGCTTGAACCGGTAAATATATTAGACCGTATTATTG
CGGAGACCAAGCTGACTCCGCAGGATGAAGCCTATGACATCGCAAAACGGGGTGTCAGCGCATTTATTGA
AGAGCTTCTGAAAAGTAAATCTTCTGCGGAACCGGTAAAAAAAGCCTTAGTCGATAAAATGATCGCGGCT
ATTGATGAAAAGCTCAGTCGTCAGGTAGATGAAATTCTGCACAATACTAAATTTCAGCAAATGGAATCGG
CGTGGTGTGGGTTGAAAATGGTGGTTGATCGTACCGATTTTGATCAGAACATTAAGCTGGAAATACTTAA
CGTTTCTAAAGAGGACCTGCTTGATGATTTTGAGGACGCTTCGGATATTACCCACTCCGGCTTATATAAA
CATATTTATACCTCAGAATATGGTCAGTTCGGTGGTCAGCCGGTCGGCGCTATTATTGCTAACTATGCAT
TCGGACCATCCGCACCGGACGTGAAAATATTGCAATACGCCTCTTCTGTTGCTGCGATGTCTCATGCACC
TTTTATCTCTGCTGCAGGTCCTAAATTCTTTGGTCTGGAAAGTTATGAGGGTTTGCCAAACATTAAAGAT
CTGAACGATCATTTTGATGGCCCTCAGTACACCAAATGGCAGAGTTTTCGTGAAACCGAAGACAGTCGTT
ATGTGGGTTTGACTCTGCCTCGTTTTCTTTTACGTCAGCCATATAGTCCTGAAGATAACCCAGTTAAAAC
ATTTGTTTATCAGGAAGATGTATCGGCGACCCATGAACATTATCTATGGGGTAATTCAGCTTATGCGTTT
GCTACCCGTCTGACAGAAAGTTTTGCTAAATATCGCTGGTGTCCAAATATTATCGGCCCTCGTTCCGGTG
GCGCAGTAAATGATTTGCCTCTGCATCATTTCGAAAGCATGGGGGAAATTGAAACAAAGATTCCGACAGA
GGTATTAGTTTCTGATCGCCGAGAATATCAGTTGGCTGAGCAGGGGTTCATTTCTCTGACAATGAGGAAA
GGCTCTGATAATGCCGCTTTCTTTTCTGCTAATTCTGCACAAAAACCAAAGTTTTTTGGTAATAGCGAAG
AGGGTAAGAAAGCTGAACTTAATTACAAGCTTGGCACCCAACTGCCGTATATGTTTGTTATATGTCGTTT
AGCTCATTACATCAAAGTATTACAGCGTGAGCAGATTGGTTCATGGAAAGAGCGAACTCAGCTGGAAACG
GAACTGAATAAGTGGCTGCGCCAGTACATCGCTGATCAGGAAAATCCGCCAGCAGAAGTACGTAGTCGTC
GCCCTCTGCGTGCGGCTCAAATCACGGTGGAAGATGTAGATGGTGAACCGGGCTGGTACCGGGTTGGCAT
CGCCGTACGTCCCCATTTCAAATTTATGGGGGCAGATTTCACTCTTTCCCTTGTCGGTAAGCTTGATAAG
GAATAA