SecReT6
Protein ID: 237806972
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0196
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]215682..216095 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDC4L827
KEGG IDtau:Tola_0196
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.20E-17, Aligned region: 22..113
Protein Sequence: 137 a.a.     [Download]
>gi|237806972|ref|YP_002891412.1| type VI secretion system lysozyme-like protein [Tolumonas auensis DSM 9187]
MGYGSLFERLNGETVGRNSQLTEESLAASILNHLNKLLQTRQGTVLCLPDYGLPDLNDGNASIYDSINRI
RRHVGWIISRYEPRLSGIRVIYVPDAGSLLALRFRITGTMQKDGLVAPLTVGVDVYSGSELRLQRVV
 
Nucleotide Sequence: 414 bp     [Download]
>ref|NC_012691.1|:215682-216095 type VI secretion system lysozyme-like protein [Tolumonas auensis DSM 9187]
GTGGGCTACGGCAGTCTGTTTGAAAGGCTGAACGGTGAAACGGTTGGCCGCAATTCACAGCTGACCGAAG
AGAGTCTGGCCGCGTCGATACTGAATCATTTGAATAAGCTGCTGCAGACACGGCAGGGAACTGTTCTTTG
CCTGCCTGATTATGGTTTACCTGACTTAAATGATGGGAATGCCAGTATCTATGACTCAATTAACCGGATC
CGTCGTCATGTGGGCTGGATTATCAGTCGATATGAGCCTCGTTTGAGTGGTATTCGGGTGATATATGTGC
CTGATGCGGGATCTCTGCTTGCGCTGAGGTTCCGCATTACAGGAACAATGCAGAAAGATGGTCTGGTGGC
TCCGCTGACTGTGGGGGTGGACGTGTATAGTGGTTCTGAATTGAGGTTGCAACGTGTCGTTTAA