SecReT6
Protein ID: 237806973
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0197
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]216085..217842 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDC4L828
KEGG IDtau:Tola_0197
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-164, Aligned region: 3..584
Protein Sequence: 585 a.a.     [Download]
>gi|237806973|ref|YP_002891413.1| type VI secretion protein [Tolumonas auensis DSM 9187]
MSFNQYFQSELLALKELGQDFSRKNPALAPFLSQDGRDPDVERLFEGFAFISGRLRQKLDDELPELSHSL
LQLLWPNYLRPVPSFGMLEFKPVHQANQIPVVPKGACMSSTAGKSANGQFQTCFDTALQPLQIEGVSFYP
QGDAGVIQLELTPIADVSIADLFLSSLRLHFAGERAVTTSLYFSLLQLTQRVLLLLKDEQGQVLEQLTLE
HSQIRPVGFSKDERLLDYPLNCFDGYVLLQEYFSFPQKFLFVEVGGLSMLQFCKQQAQARSIELQFELSR
TPMMHFQPKKENVHLYCSPVANVFNTHAIPIRYDQRQTEYKVIPADIGLDTSSIISINTVTGWLPGNIGM
REFNQFESFRNHDCDDGNAYFRARYKPGIGNHGTETWLSFNNTQAGEQMAETISVDLTCCDHSLAHHINV
GDITVAGDGMPQFASFRNITPLSATYPPPMSGDILWRIISNMSLNYQSLADVQALRVVLETYDFPGFYDD
KKARRTRKMLDGIKRITQKAGDRIWQGLPVRGMRTEIEMDVSHFLCEGDMFLFAAILNEFFCSFTSLNTF
HQLQVKSSDGVIYSWAPRMGQQVLS
 
Nucleotide Sequence: 1758 bp     [Download]
>ref|NC_012691.1|:216085-217842 type VI secretion protein [Tolumonas auensis DSM 9187]
GTGTCGTTTAACCAATATTTCCAGAGTGAGTTACTGGCGTTGAAAGAGTTAGGGCAGGATTTTTCCCGGA
AGAATCCTGCTCTGGCTCCTTTTCTCAGTCAGGATGGCCGCGATCCCGATGTGGAACGCCTATTTGAGGG
ATTTGCATTTATCTCCGGCCGTTTGCGGCAGAAGCTAGATGATGAGCTGCCTGAGTTAAGCCATTCATTA
CTACAACTTCTTTGGCCGAACTATCTGCGTCCGGTTCCCAGTTTTGGCATGCTGGAATTTAAACCGGTGC
ATCAGGCAAATCAGATCCCTGTCGTACCGAAAGGTGCTTGCATGTCCTCAACTGCAGGCAAATCAGCCAA
TGGTCAGTTTCAGACTTGTTTTGACACGGCATTACAGCCGTTGCAAATAGAAGGGGTTAGTTTCTATCCG
CAGGGGGATGCAGGTGTTATTCAGTTGGAATTAACACCGATAGCAGATGTATCCATTGCTGATTTGTTTC
TTTCTTCTTTGCGTCTGCACTTTGCGGGTGAACGTGCGGTTACTACGTCTCTTTATTTCAGTCTGCTGCA
ACTGACACAGCGTGTTTTATTGCTGCTGAAAGATGAGCAGGGGCAAGTTCTGGAACAGCTGACGCTTGAG
CATTCGCAGATCCGTCCGGTTGGTTTCAGTAAAGATGAGCGGTTGCTGGATTATCCGCTTAACTGTTTCG
ATGGTTATGTACTGCTACAGGAGTATTTCTCTTTTCCTCAGAAATTCTTGTTTGTGGAAGTGGGGGGATT
ATCCATGCTGCAATTCTGCAAACAGCAAGCACAAGCCCGCAGCATTGAGTTGCAGTTTGAACTATCGCGT
ACACCAATGATGCATTTTCAACCGAAGAAAGAGAATGTGCATTTATATTGCTCGCCGGTTGCAAATGTTT
TCAACACTCATGCGATCCCGATTCGTTACGATCAGCGCCAGACTGAATATAAAGTAATTCCGGCGGACAT
TGGTCTGGACACATCCAGTATCATTTCGATTAATACGGTAACCGGTTGGTTGCCCGGTAACATTGGTATG
CGGGAATTCAATCAGTTCGAAAGTTTTCGTAATCATGATTGTGACGACGGGAATGCTTATTTCCGGGCGC
GTTACAAGCCGGGGATTGGCAATCACGGCACGGAAACCTGGCTGAGTTTTAATAATACTCAGGCGGGGGA
GCAAATGGCGGAAACGATTTCTGTCGATCTTACATGCTGCGATCACTCATTGGCCCATCATATAAACGTG
GGGGATATCACTGTGGCGGGTGATGGGATGCCGCAATTCGCTTCTTTCCGGAATATCACTCCATTGTCAG
CTACCTATCCTCCACCCATGTCGGGCGATATTTTATGGCGGATCATCTCCAATATGTCGTTGAATTATCA
GTCTCTGGCAGATGTACAGGCTTTGCGTGTAGTGCTGGAAACCTATGACTTCCCTGGTTTCTATGATGAT
AAGAAAGCACGGCGAACCAGAAAGATGCTGGATGGTATTAAACGGATAACACAGAAGGCCGGTGACCGAA
TTTGGCAGGGATTGCCGGTACGGGGAATGCGTACTGAAATTGAAATGGATGTGTCTCACTTCCTCTGTGA
AGGTGACATGTTTTTATTTGCTGCAATTCTGAATGAGTTTTTCTGCAGTTTTACCAGCCTTAATACATTT
CATCAGTTACAGGTGAAAAGTAGTGATGGAGTGATTTACTCATGGGCACCGCGTATGGGTCAGCAAGTAC
TGAGCTGA