SecReT6
Protein ID: 237806974
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0198
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]217806..218825 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDC4L829
KEGG IDtau:Tola_0198
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.50E-72, Aligned region: 21..321
Protein Sequence: 339 a.a.     [Download]
>gi|237806974|ref|YP_002891414.1| type VI secretion protein [Tolumonas auensis DSM 9187]
MGTAYGSASTELMAGPFAGSVRRYNLFQAIDLSCKWLSQVNQIDEEQAYGLIAFAGNSSLAFPKSEIEEV
FFYLEQGVVRAKFIINSINLFGAGSPLPAHYYEPIAYDDEQGRVVRDFIDLFNQRLQALIYPIWKKYRYY
MQFEPAAKDAFSERMFALIGLGYQELRRSSHIEWPRLLPYLGLLSIKVQSAAVLESVLRYYFNHKALFIE
QCVVRRVTIPAEQWNQLGLVNHRLGQSLVLGESILDRHTTFRIHIRELDWDTFHFFLPIGEGYAVLRELV
GFILREPLEYDIRLSMPDRSSQPLMLSGNNKCRLGWTTWFGLEADEGTITVAGNINDNN
 
Nucleotide Sequence: 1020 bp     [Download]
>ref|NC_012691.1|:217806-218825 type VI secretion protein [Tolumonas auensis DSM 9187]
ATGGGCACCGCGTATGGGTCAGCAAGTACTGAGCTGATGGCGGGCCCCTTTGCCGGATCAGTCAGACGTT
ACAATTTGTTTCAGGCTATCGACTTGAGCTGTAAATGGCTGTCACAAGTCAATCAGATCGATGAAGAGCA
GGCATATGGGCTGATTGCTTTTGCGGGGAACAGTTCACTGGCCTTTCCGAAAAGTGAGATTGAAGAGGTC
TTTTTTTATCTGGAACAGGGTGTCGTTCGGGCGAAATTTATCATTAACAGTATCAACCTGTTTGGAGCCG
GTTCACCTTTACCTGCGCATTATTACGAACCGATTGCTTACGATGATGAACAAGGGCGTGTCGTCCGTGA
TTTTATCGATCTGTTTAATCAGCGCTTACAGGCGTTGATTTATCCGATCTGGAAAAAATATCGCTATTAC
ATGCAGTTTGAACCCGCTGCCAAGGATGCTTTTTCTGAGCGGATGTTCGCATTGATCGGGCTGGGATATC
AGGAGTTACGGCGTAGCAGTCATATTGAATGGCCTCGCTTATTACCGTATCTGGGGTTGTTGAGTATCAA
GGTGCAGTCAGCTGCAGTGCTTGAATCGGTATTGAGGTATTACTTCAATCATAAAGCATTGTTTATTGAA
CAATGTGTCGTCCGGCGGGTAACTATCCCGGCTGAACAATGGAACCAGCTTGGTCTTGTAAATCATCGGC
TGGGACAGAGTCTGGTGTTGGGTGAAAGCATCCTCGATCGGCACACAACATTTCGTATCCATATCCGGGA
ATTGGACTGGGACACGTTTCATTTTTTTCTGCCCATTGGCGAAGGCTATGCAGTATTGCGTGAGCTGGTG
GGTTTTATTTTACGGGAACCACTGGAGTATGACATCCGCTTGTCGATGCCCGATCGGTCATCACAACCGC
TGATGCTCTCTGGCAATAATAAGTGTCGGCTGGGCTGGACTACTTGGTTTGGACTAGAAGCTGATGAAGG
CACGATAACTGTCGCGGGTAATATAAATGATAACAATTAA