SecReT6
Protein ID: 237806975
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0199
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]218812..221421 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDC4L830
KEGG IDtau:Tola_0199
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.50E-42, Aligned region: 208..283
AAA_2 [PF07724], Evalue: 9.50E-42, Aligned region: 603..769
AAA [PF00004], Evalue: 3.80E-20, Aligned region: 210..341
AAA [PF00004], Evalue: 3.80E-20, Aligned region: 608..690
ClpB_D2-small [PF10431], Evalue: 1.20E-13, Aligned region: 777..847
AAA_5 [PF07728], Evalue: 2.10E-12, Aligned region: 210..230
AAA_5 [PF07728], Evalue: 2.10E-12, Aligned region: 607..728
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 187..229
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 254..288
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 600..643
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 671..701
AAA_22 [PF13401], Evalue: 4.20E-10, Aligned region: 209..294
AAA_22 [PF13401], Evalue: 4.20E-10, Aligned region: 476..525
AAA_22 [PF13401], Evalue: 4.20E-10, Aligned region: 605..701
AAA_19 [PF13245], Evalue: 6.80E-07, Aligned region: 207..231
AAA_19 [PF13245], Evalue: 6.80E-07, Aligned region: 589..629
AAA_17 [PF13207], Evalue: 2.00E-06, Aligned region: 210..273
AAA_17 [PF13207], Evalue: 2.00E-06, Aligned region: 607..642
AAA_29 [PF13555], Evalue: 0.00011, Aligned region: 204..226
AAA_29 [PF13555], Evalue: 0.00011, Aligned region: 601..632
Sigma54_activat [PF00158], Evalue: 0.00012, Aligned region: 206..226
Sigma54_activat [PF00158], Evalue: 0.00012, Aligned region: 607..725
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 190..224
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 262..293
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 606..626
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 678..689
IstB_IS21 [PF01695], Evalue: 0.00024, Aligned region: 204..231
IstB_IS21 [PF01695], Evalue: 0.00024, Aligned region: 607..625
AAA_18 [PF13238], Evalue: 0.00041, Aligned region: 210..230
AAA_18 [PF13238], Evalue: 0.00041, Aligned region: 608..646
DUF258 [PF03193], Evalue: 0.00047, Aligned region: 179..229
DUF258 [PF03193], Evalue: 0.00047, Aligned region: 583..618
AAA_25 [PF13481], Evalue: 0.00099, Aligned region: 210..234
AAA_25 [PF13481], Evalue: 0.00099, Aligned region: 266..294
AAA_25 [PF13481], Evalue: 0.00099, Aligned region: 411..457
AAA_25 [PF13481], Evalue: 0.00099, Aligned region: 601..636
NACHT [PF05729], Evalue: 0.0014, Aligned region: 210..230
NACHT [PF05729], Evalue: 0.0014, Aligned region: 267..312
NACHT [PF05729], Evalue: 0.0014, Aligned region: 607..651
TIP49 [PF06068], Evalue: 0.0023, Aligned region: 210..247
TIP49 [PF06068], Evalue: 0.0023, Aligned region: 258..290
TIP49 [PF06068], Evalue: 0.0023, Aligned region: 607..642
Clp_N [PF02861], Evalue: 0.0027, Aligned region: 41..75
Clp_N [PF02861], Evalue: 0.0027, Aligned region: 104..120
Clp_N [PF02861], Evalue: 0.0027, Aligned region: 515..546
Clp_N [PF02861], Evalue: 0.0027, Aligned region: 840..850
T2SE [PF00437], Evalue: 0.0043, Aligned region: 177..228
T2SE [PF00437], Evalue: 0.0043, Aligned region: 591..685
Zeta_toxin [PF06414], Evalue: 0.0088, Aligned region: 204..229
Zeta_toxin [PF06414], Evalue: 0.0088, Aligned region: 606..647
Protein Sequence: 869 a.a.     [Download]
>gi|237806975|ref|YP_002891415.1| type VI secretion ATPase, ClpV1 family [Tolumonas auensis DSM 9187]
MITIKLDELISALAPAEKQALEQAANYCVARAGSEILVEDYLLALLDGSDSFLNKVLLQFSLSADTLRTI
LLESVGYQKTESRNPVFSTLLVNWLEEAFLITKLQLQQSSIACLALLLAIQDRPEKYARTRYGQFFSDIP
REKLMALMDGLQAEVLSAMSVSGAGSALQQFTKSYTQLARDGKLDPVLCRDEEIRQIVDILSRRRKNNPI
LVGEAGVGKTAVVEGLAQHVIAGLVPPALTGIELLELDMGLLQAGASVKGEFERRLKAVIDEVNASPKPI
VLFIDEAHTLIGAGGQAGGGDAANLLKPALARGTLRTLAATTWSEYKKYFEKDPALARRFQPVQVLEPTI
TQATTILRGLVSRYEVAHDVYLRDDAVVTAAELSARYLSGRQLPDKAIDLLDTACARVKNSQHATPIRLQ
AIATSLAEKQRLQTALLRDQQHGLPVEPGQLAALERQIPQLEQEHAELSAHWQEQKTLVAQLVASRNPEV
SSLLSAADNQSEITAELVDVDVEAPETVLAALAELQQSQGILIHHEVTPQVVAEVISSWTAIPVENLIEA
PSARVVEFADRLRARIRGQAHAVSLIERAVKATAAGLGNPLAPTGVFLLAGPSGVGKTETAVAVAELLYG
GERFLTTINMSEFQEKHSLSRLIGSPPGYVGYGEGGILTEAVRQRPYSVILLDEVEKADPDILNLFYQIF
DKGIANDGEGRVINFRNTLIFMTSNLASAEISSLAAGETPVMTDSITETIRPVLAKHFKPALLARMNIIP
YLPIANDVMHELVLLRLQKLSQRIASRGIALTFDAAVVTAIAESCTRTDTGARNIDFLVNNYLLPAISDR
ILKALTQQENIRGIRVVQDEYGNFELIIG
 
Nucleotide Sequence: 2610 bp     [Download]
>ref|NC_012691.1|:218812-221421 type VI secretion ATPase, ClpV1 family [Tolumonas auensis DSM 9187]
ATGATAACAATTAAATTAGATGAGCTGATTAGTGCTCTGGCTCCTGCTGAAAAGCAGGCGCTGGAACAGG
CAGCAAATTACTGTGTAGCGCGGGCGGGAAGTGAAATATTAGTTGAAGACTATTTGCTCGCGTTGCTGGA
TGGTTCGGATAGCTTCCTGAATAAAGTGTTGCTGCAATTTTCACTGAGTGCTGACACGTTGCGTACCATT
CTGCTGGAGTCCGTCGGATACCAGAAAACAGAAAGCCGGAATCCGGTATTCTCAACGTTGTTAGTTAACT
GGCTGGAAGAAGCTTTTCTGATAACAAAACTGCAACTGCAACAGTCTTCTATTGCTTGTCTTGCATTATT
ACTGGCGATTCAGGATCGACCGGAGAAATACGCACGTACCCGCTATGGTCAGTTTTTCTCTGATATTCCC
CGCGAAAAGCTGATGGCTTTAATGGATGGTTTGCAGGCGGAAGTTCTGTCTGCCATGTCAGTTTCTGGTG
CGGGGAGTGCTCTGCAGCAGTTCACCAAAAGCTACACCCAGCTGGCAAGAGATGGAAAGTTAGATCCGGT
GTTGTGCCGGGATGAAGAGATCCGCCAGATTGTGGATATTTTATCGCGTCGTCGTAAAAACAATCCGATT
CTGGTTGGTGAAGCCGGGGTTGGTAAAACCGCCGTAGTGGAGGGGTTGGCACAGCACGTCATCGCGGGGC
TGGTGCCACCTGCATTGACGGGGATTGAACTGCTGGAACTGGATATGGGGTTGTTGCAAGCCGGAGCCAG
TGTAAAGGGTGAATTTGAGCGACGTCTTAAGGCGGTCATTGATGAGGTCAACGCATCACCTAAGCCAATT
GTGTTATTTATCGATGAAGCACATACCCTGATAGGTGCCGGTGGTCAGGCGGGTGGCGGTGATGCGGCTA
ATCTATTGAAACCGGCTCTGGCTCGCGGAACTCTGCGTACACTGGCTGCAACTACATGGTCAGAATACAA
AAAATATTTTGAGAAAGACCCTGCTCTGGCACGTCGGTTCCAGCCCGTTCAGGTACTGGAACCGACTATT
ACTCAGGCAACAACCATCCTGCGCGGCTTAGTCTCCCGTTACGAAGTCGCGCATGATGTCTATCTGCGCG
ATGATGCTGTCGTGACAGCCGCAGAATTATCCGCGCGTTATTTATCAGGCCGTCAGTTGCCGGATAAGGC
AATTGATTTGCTGGATACTGCATGTGCCCGGGTAAAAAACAGCCAGCATGCAACCCCCATACGTCTGCAG
GCCATCGCGACTTCCCTGGCTGAAAAACAGCGTTTGCAGACGGCATTATTGCGTGATCAGCAGCATGGTT
TGCCTGTCGAACCAGGACAACTGGCTGCTCTGGAACGTCAGATCCCGCAGTTGGAACAAGAACACGCTGA
ATTGTCTGCACACTGGCAAGAGCAAAAAACGCTGGTGGCACAGTTGGTTGCCAGTCGTAATCCTGAGGTT
TCATCACTGCTGTCTGCAGCAGATAATCAGTCGGAAATTACCGCTGAGCTTGTGGATGTGGATGTCGAGG
CTCCTGAAACTGTTCTGGCCGCATTAGCCGAATTGCAGCAGTCACAAGGCATTCTGATCCATCATGAAGT
GACACCACAAGTTGTGGCGGAAGTTATTTCCAGTTGGACAGCCATTCCGGTAGAAAATCTGATTGAAGCG
CCATCTGCACGGGTTGTTGAATTCGCCGATCGACTACGAGCCCGTATCCGTGGTCAGGCTCATGCGGTTT
CATTAATTGAACGAGCTGTAAAAGCCACTGCGGCCGGGTTGGGTAATCCTCTGGCGCCAACAGGGGTGTT
CCTGCTGGCAGGGCCAAGTGGTGTTGGTAAAACTGAAACCGCGGTTGCTGTTGCCGAACTGCTGTATGGC
GGTGAACGTTTTCTGACCACGATTAATATGTCTGAATTTCAGGAAAAGCATTCGCTTTCCCGTCTGATCG
GTTCTCCACCCGGATATGTGGGGTATGGTGAAGGTGGAATATTAACCGAAGCCGTCCGTCAACGACCATA
TTCAGTGATTTTGCTGGATGAGGTGGAAAAAGCTGACCCTGACATTCTGAATCTTTTTTATCAAATCTTT
GATAAAGGCATCGCCAATGATGGTGAAGGCCGGGTAATCAATTTCCGCAATACCCTGATTTTTATGACAT
CAAATCTGGCATCAGCAGAGATCAGCTCGCTGGCAGCCGGTGAAACGCCGGTAATGACCGATTCGATAAC
AGAAACGATCCGTCCGGTGCTGGCTAAACATTTTAAACCTGCATTGCTGGCACGCATGAACATTATTCCT
TATCTGCCAATTGCAAACGATGTGATGCATGAACTGGTGTTGCTGCGCTTGCAGAAACTGTCGCAACGGA
TTGCATCCCGCGGAATCGCGTTGACCTTTGACGCTGCGGTGGTAACGGCCATTGCCGAGAGCTGCACCCG
GACTGACACCGGTGCCCGGAATATCGATTTTCTGGTTAATAACTATCTGTTACCGGCAATTTCAGATCGC
ATTCTGAAAGCGCTGACGCAGCAGGAAAATATCCGCGGCATTCGGGTAGTACAGGATGAATACGGTAATT
TTGAACTGATTATCGGGTAA