SecReT6
Protein ID: 237806978
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0202
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]222575..223870 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDC4L8G2
KEGG IDtau:Tola_0202
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.00E-13, Aligned region: 29..97
Protein Sequence: 431 a.a.     [Download]
>gi|237806978|ref|YP_002891418.1| FHA domain-containing protein [Tolumonas auensis DSM 9187]
MPLILDLVNAEGQSSAQKSSVTFRNAGGTIGRADSATWMLADRSRHISGVHAEISYEEGVYYLTDRSTNG
IYDVAKNARLQKNEDYPIAHGDRFRMGSFVFKARVLQDADHFEHQIMGEPSSVSALIPDDEFLDTDPLAM
LNAPEIPSEDFELGEFSVRRDDNFALNESFDDLDEPFLSPTLASVPLAKEEQAMLAALDISNPIPVRPVP
LKPEKTGSPVAGSPASAHAPDSAQRVLQVLGSAMDFDFGKLTQDELDSVLQNLGVLTKHAVQGLQQVLRT
RADIKNKLRLGSTMVQESGNNPLKLPGNYTQTLNCMLLGQIGYLSGPQAVRQALKDIQAHQVSSFAASRT
ILDSVFEQFSPTQLVYRFETAGKPGKWGSKDAYYWQQYQLHHQKMSGDQEWRQSQFIKDYARVYEEQAQY
INAAWSELDAR
 
Nucleotide Sequence: 1296 bp     [Download]
>ref|NC_012691.1|:222575-223870 FHA domain-containing protein [Tolumonas auensis DSM 9187]
ATGCCGCTGATTTTAGATCTGGTGAATGCTGAGGGGCAGTCATCTGCACAAAAGAGTTCGGTCACTTTCC
GGAATGCCGGAGGAACTATTGGCCGGGCAGACTCTGCTACCTGGATGCTGGCTGATCGCAGCCGGCATAT
TTCAGGGGTTCATGCAGAAATCAGTTATGAAGAGGGTGTTTATTATCTGACTGATCGCAGCACGAACGGT
ATCTATGATGTCGCTAAAAATGCCCGCCTGCAAAAAAATGAAGATTATCCGATCGCGCATGGGGACCGTT
TCCGGATGGGCAGTTTTGTTTTTAAGGCCCGCGTATTACAGGATGCGGATCATTTTGAACACCAGATCAT
GGGTGAGCCATCCTCTGTTTCAGCGTTGATTCCGGATGATGAGTTTCTGGATACAGATCCATTGGCCATG
CTGAATGCTCCGGAGATACCTTCAGAAGATTTTGAGCTGGGTGAGTTCTCTGTGCGCAGAGACGATAATT
TTGCGTTGAATGAATCCTTTGATGATCTCGATGAACCATTCTTGTCACCGACATTGGCTTCTGTGCCTTT
GGCTAAGGAAGAACAGGCGATGCTTGCTGCATTAGATATCTCAAATCCGATCCCAGTGCGCCCGGTACCG
CTTAAACCTGAAAAGACTGGATCTCCGGTTGCCGGTTCCCCAGCTTCGGCTCATGCACCGGACTCTGCAC
AACGTGTGTTGCAGGTGCTTGGGAGCGCGATGGATTTTGATTTCGGCAAGCTGACTCAGGATGAGCTGGA
TTCGGTATTACAAAATCTGGGAGTACTGACGAAACACGCGGTTCAGGGATTACAGCAGGTGCTGCGAACA
CGGGCCGACATTAAAAATAAACTGCGTCTTGGCAGCACCATGGTACAGGAAAGCGGGAATAACCCACTGA
AATTACCAGGTAATTACACGCAGACCCTGAATTGCATGTTACTGGGGCAGATTGGTTATTTATCTGGTCC
GCAGGCTGTGCGTCAGGCATTGAAAGATATTCAGGCACATCAGGTTTCCAGTTTTGCCGCCAGTCGGACC
ATCCTTGATTCGGTGTTTGAGCAATTCTCACCCACACAGTTGGTCTATCGTTTTGAGACCGCCGGGAAGC
CAGGGAAATGGGGCAGTAAAGACGCTTACTACTGGCAACAATATCAATTACATCATCAGAAAATGTCTGG
CGATCAGGAATGGCGGCAGAGTCAGTTTATTAAAGACTACGCACGGGTTTATGAAGAGCAGGCGCAGTAT
ATCAATGCCGCCTGGTCAGAGTTGGATGCACGGTGA