SecReT6
Protein ID: 237806979
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0203
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]223876..224427 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDC4L8G3
KEGG IDtau:Tola_0203
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.40E-37, Aligned region: 10..144
Protein Sequence: 183 a.a.     [Download]
>gi|237806979|ref|YP_002891419.1| type VI secretion lipoprotein [Tolumonas auensis DSM 9187]
MKNKFFMAACGVFLSACSSTPDPTLLDLTMTADADLNPDLTSRPSPMIVKLVELKSHTAFGNADYFALAG
NTKNTLGPDYVAEEVLPVRPGESKTLKLRLHPGSRFIGVIAEYRALDKAVWRYVIQPEKEDFSAIRLALT
RDAIRPLTPAQYEDKQGSATALNVSQIEQKTTGVASNSAVNLQ
 
Nucleotide Sequence: 552 bp     [Download]
>ref|NC_012691.1|:223876-224427 type VI secretion lipoprotein [Tolumonas auensis DSM 9187]
ATGAAAAATAAATTCTTCATGGCTGCTTGTGGTGTGTTTTTGTCGGCCTGCAGTAGTACGCCCGATCCAA
CTTTACTGGATCTGACGATGACGGCAGATGCCGATTTGAATCCGGATTTAACCAGTCGTCCATCGCCGAT
GATCGTTAAGCTGGTTGAGCTCAAATCACATACAGCATTCGGAAATGCAGACTATTTCGCATTGGCCGGA
AATACCAAAAACACACTGGGTCCGGATTATGTCGCTGAGGAAGTATTGCCAGTTCGGCCCGGTGAGAGCA
AAACACTCAAATTACGTCTTCATCCGGGATCCCGCTTTATCGGCGTGATTGCTGAATACCGGGCGTTGGA
TAAAGCGGTCTGGCGGTATGTGATCCAGCCTGAAAAAGAGGATTTTTCTGCTATTCGTTTAGCGTTAACC
AGAGATGCAATCCGTCCACTGACTCCGGCACAGTATGAAGATAAGCAAGGCAGTGCCACTGCTCTGAATG
TCTCTCAGATAGAACAAAAAACCACAGGTGTCGCGTCAAATTCAGCGGTGAATTTGCAGTAA