SecReT6
Protein ID: 237806980
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0204
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]224501..225844 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDC4L8G4
KEGG IDtau:Tola_0204
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.80E-123, Aligned region: 16..445
Protein Sequence: 447 a.a.     [Download]
>gi|237806980|ref|YP_002891420.1| type VI secretion protein [Tolumonas auensis DSM 9187]
MERIVWREGMLLRPQHLQQQDHYYQHQFRELLQMTSPCNWGFFEAEIDKQYLMMGKVVVSRAAGILPDGA
LFRIGENDHPAVEVKKDLYDAVVYLALPLVTGNAVENRLAEEHQVVTPFVSFEKLAYDTNYGERNSCAVL
CCRHDFRLLVEPAGGNNELPDEASWIKMPLCRISDVSADGFVTLDEHFQPSFLHFGECAPYQGYLRELVN
LLAHRGDTLAGRIRNTGRFGTSEVGDFLMLALINRNETRLRHLMQFRQIHPERVFMEMVSLHSELASFNG
DSRRPLNELSYIHTAQYACFHRVMNELRLHLSQVIEQHAVELPLQSRKYGILVSPLQDRTLLDNSQFVLT
AQADCEQEQLRNRLPAQMKVGPVEQIRQMVNLHLPGINLRPLAAAPRQLPFHARHIYFSLELDAAMRAQL
ESSGGFALHVAGEFPELQLSLWAIRNN
 
Nucleotide Sequence: 1344 bp     [Download]
>ref|NC_012691.1|:224501-225844 type VI secretion protein [Tolumonas auensis DSM 9187]
ATGGAAAGAATCGTTTGGCGCGAGGGGATGCTATTACGGCCACAGCATCTCCAGCAGCAAGATCATTATT
ATCAGCATCAGTTCCGGGAACTGTTGCAGATGACCTCGCCCTGTAACTGGGGATTCTTTGAGGCCGAAAT
TGATAAACAATACCTGATGATGGGGAAGGTCGTGGTGTCCCGGGCGGCAGGTATTCTGCCGGATGGCGCT
CTCTTCCGGATTGGTGAAAATGATCATCCGGCTGTGGAGGTTAAAAAAGATCTCTACGATGCGGTGGTAT
ATCTGGCATTACCATTAGTCACTGGCAACGCCGTTGAAAATCGTCTTGCTGAAGAGCACCAGGTTGTTAC
CCCGTTTGTCAGTTTTGAAAAACTGGCCTATGACACCAACTACGGCGAGCGTAACAGTTGTGCCGTACTT
TGCTGTCGTCATGATTTTCGCTTACTGGTAGAGCCGGCTGGCGGTAATAATGAGCTGCCGGATGAGGCCA
GCTGGATCAAAATGCCGCTGTGCCGGATCTCTGATGTCAGCGCCGATGGGTTTGTCACGCTGGATGAGCA
TTTTCAGCCCAGTTTTCTGCATTTTGGCGAATGTGCACCCTATCAGGGCTATCTGCGGGAATTAGTGAAT
CTGCTGGCACACCGCGGCGATACGCTGGCGGGACGTATCCGCAATACCGGCCGTTTTGGTACATCAGAAG
TAGGCGATTTTCTGATGCTGGCGCTCATTAACCGGAATGAAACCCGGTTGCGTCATTTGATGCAGTTCAG
ACAGATACATCCGGAACGTGTTTTTATGGAAATGGTCTCGCTGCATAGTGAGCTGGCCTCGTTCAATGGT
GATAGTCGTCGTCCTCTGAATGAGTTGAGCTACATCCATACCGCACAGTATGCCTGTTTCCACCGTGTGA
TGAATGAATTACGTCTGCATCTGAGTCAGGTGATTGAACAACATGCGGTTGAATTACCGCTGCAATCCCG
GAAATACGGCATTCTGGTTTCCCCGTTACAAGACAGAACGTTACTTGATAATTCACAGTTCGTACTGACG
GCGCAGGCCGATTGTGAGCAGGAACAATTACGTAACCGTTTACCTGCCCAAATGAAAGTGGGGCCGGTTG
AACAGATCCGTCAGATGGTGAATCTGCATTTGCCCGGCATTAATCTGCGCCCGCTGGCCGCAGCGCCTCG
TCAGTTGCCATTCCATGCCCGCCATATTTATTTTTCACTGGAATTAGATGCGGCTATGCGCGCCCAACTG
GAGAGTTCCGGTGGTTTCGCGCTGCATGTAGCTGGTGAATTTCCTGAACTGCAACTCAGTCTCTGGGCTA
TAAGGAATAACTAA