SecReT6
Protein ID: 237806981
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0205
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]225846..226712 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDC4L8G5
KEGG IDtau:Tola_0205
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-60, Aligned region: 61..265
Protein Sequence: 288 a.a.     [Download]
>gi|237806981|ref|YP_002891421.1| DotU family type IV / VI secretion system protein [Tolumonas auensis DSM 9187]
MAMANSEHTVFLGHRETDDEEIIVPLPKTKSNAAVRYQQLDDRMIYAARLRDEKMLNVGTNPLLAAASPL
FQAIADVSSEGYAAPAGLKEELVKRIKDFEFMALSQGCDNTEIIASRYVLCTALDEAITTKPWSTRLEWT
KNSLLIIFHNEANGGEKLFQLLDKLSRNPTRHINVLELIYVFLSLGYEGKYRVLQRGLSELDAIRNSLYR
QIRMIRGEQQKDLAINWQPVVSGRQKLPVYIPVWLIVVMALCCLGLVYAGFDYVLEQQTHVITNMYQDAG
QKQGHNAQ
 
Nucleotide Sequence: 867 bp     [Download]
>ref|NC_012691.1|:225846-226712 DotU family type IV / VI secretion system protein [Tolumonas auensis DSM 9187]
ATGGCGATGGCTAATTCGGAACATACTGTATTTCTTGGGCACAGAGAAACGGATGACGAAGAGATCATCG
TCCCGTTACCCAAGACAAAATCGAATGCGGCAGTCCGTTATCAGCAACTGGATGATCGCATGATTTACGC
GGCCCGCCTGCGTGATGAAAAAATGCTGAACGTTGGGACCAACCCGTTACTGGCGGCAGCGTCACCGCTG
TTTCAGGCCATTGCTGACGTTTCCTCTGAAGGGTATGCCGCTCCGGCAGGACTCAAAGAAGAACTGGTAA
AGCGAATTAAAGATTTTGAATTCATGGCGTTATCACAAGGATGTGACAACACGGAAATTATCGCATCGCG
TTATGTTCTGTGTACGGCGCTGGATGAAGCGATTACGACCAAACCCTGGAGCACCCGTCTGGAGTGGACG
AAAAACAGTCTGCTGATAATCTTCCATAATGAAGCTAACGGCGGGGAAAAACTCTTCCAGCTATTGGATA
AGTTATCCCGTAATCCAACCAGACATATCAATGTGTTAGAACTGATCTATGTCTTTTTAAGTCTGGGCTA
TGAAGGGAAATACCGGGTTCTGCAACGCGGCTTATCTGAACTGGACGCAATCCGTAACAGCCTGTATCGC
CAGATACGCATGATCCGGGGGGAGCAACAAAAAGATCTGGCCATTAACTGGCAACCGGTAGTGTCCGGAA
GGCAAAAGCTGCCTGTTTATATACCCGTCTGGCTGATTGTGGTGATGGCGTTGTGCTGTCTGGGGCTGGT
CTACGCAGGTTTTGATTATGTGCTGGAACAACAGACGCACGTCATTACCAATATGTATCAGGACGCAGGT
CAGAAACAAGGACACAACGCACAATGA