SecReT6
Protein ID: 237806985
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0209
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]231934..234045 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDC4L8G9
KEGG IDtau:Tola_0209
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-62, Aligned region: 49..360
Phage_base_V [PF04717], Evalue: 3.60E-22, Aligned region: 327..350
Phage_base_V [PF04717], Evalue: 3.60E-22, Aligned region: 399..491
DUF2345 [PF10106], Evalue: 0.0014, Aligned region: 600..653
Protein Sequence: 703 a.a.     [Download]
>gi|237806985|ref|YP_002891425.1| ImpA family type VI secretion-associated protein [Tolumonas auensis DSM 9187]
MFVSDSPDDALSSLGSSVRGLFSANESRFFLTLSGHDEDVQVLRFTAQESLNCPWELDITLVSEAENISP
EKMVGSAATLTLSGCAGRSYYHGQVWQFRRQTQGKRLTQYQLVMRPSLSWLGLGRNQRIFQQKSVPDIIR
LLLQEQHVASDQVQWKLSGTYTARDYCVQYGESDLQFITRLLGEEGIHYHFAHDEGGSKLIFADHPSGWS
TGLAAVPYKPGTGQAADEDTLQSFQVRHAVSVNMISRRYFDLHKPLQLTDAEQKTSPAAGSPSLKRNDSA
WRDHLNHYDYRSAEQQSISSAQQIAERHLESLQRTRITAQGRGNLSQLRTGWLLPIRGHGRAEFNSQWLL
TEVSLSGEQPQVLEEFSGGQSSLSCQFSAVPWDTPWRPDFAPEKPLLCGIQTACVTGPAGEEIHTDELGR
IKVQFHWDREGKEDERTSCWIRVMHDWAGNGYGVVRLPRIGQEVQVSFEDGNPDKPLITGCLHNGEQQTA
WELPVHMTRSGIRTCSSPGGGGSNELRFEDKKGKEELRWQAEKDWDAKILSCSHTQINGAHESAIGGNDY
REIEGEQHITLEADTQKEVGLNQHCTIHGSQEQHIEQKCLIQAGQNVVWQSKNQAIYHAGTELTLQAGGS
FIKLDPCGITLSGPMVTMNQGGSALSAGSESAALPHKPAGAHSAGIGKVPQAKAPEKVIKVAPEKDYRIV
YSD
 
Nucleotide Sequence: 2112 bp     [Download]
>ref|NC_012691.1|:231934-234045 ImpA family type VI secretion-associated protein [Tolumonas auensis DSM 9187]
ATGTTTGTATCAGATAGCCCGGATGATGCGCTGTCCAGCCTCGGCAGTAGTGTCCGTGGTTTATTCAGCG
CTAATGAATCGCGCTTTTTTCTTACCCTGAGCGGTCACGATGAAGACGTACAGGTTTTACGATTTACGGC
GCAGGAATCGTTGAATTGTCCATGGGAGCTGGATATTACGCTGGTCAGCGAAGCGGAAAATATATCACCG
GAGAAAATGGTGGGTAGTGCGGCCACGTTAACCTTATCGGGGTGTGCAGGCAGGAGTTATTACCACGGTC
AGGTGTGGCAATTCCGGCGGCAGACACAAGGTAAACGACTGACACAATATCAACTGGTGATGCGTCCTTC
GCTGTCCTGGCTTGGACTGGGCCGGAATCAGCGTATTTTCCAGCAAAAAAGTGTGCCCGATATCATCAGG
CTACTTCTGCAGGAACAGCATGTCGCCAGCGATCAGGTGCAGTGGAAATTAAGCGGAACATATACTGCCC
GCGATTATTGTGTTCAGTATGGCGAAAGCGATCTGCAATTTATCACGCGTTTGCTGGGCGAAGAGGGTAT
CCATTACCACTTTGCGCATGATGAAGGTGGCAGCAAGCTGATCTTTGCTGATCATCCATCAGGCTGGAGC
ACCGGGCTTGCTGCTGTACCGTATAAACCAGGTACGGGTCAGGCCGCAGATGAGGATACCCTGCAATCAT
TTCAGGTCAGACATGCTGTTTCAGTCAATATGATCTCCCGGCGTTATTTTGACCTACATAAACCACTTCA
ACTGACCGATGCAGAACAGAAAACATCACCGGCAGCGGGTAGTCCATCCCTGAAAAGGAATGACAGCGCC
TGGCGTGATCACCTGAATCACTATGATTACCGCAGTGCTGAGCAACAGAGTATCAGTTCGGCACAACAGA
TCGCTGAACGTCACCTGGAATCACTGCAGCGCACCCGTATCACCGCTCAGGGGCGCGGTAACCTGTCACA
GCTGCGTACCGGTTGGTTGTTACCGATCCGTGGACATGGTCGGGCGGAATTCAACAGTCAGTGGCTGCTT
ACTGAAGTCAGCTTAAGCGGTGAGCAGCCGCAAGTGCTGGAGGAGTTCAGTGGCGGGCAATCAAGTTTGA
GCTGTCAGTTCAGTGCTGTGCCGTGGGATACACCGTGGCGACCTGATTTTGCGCCAGAAAAACCGTTGTT
GTGCGGCATACAAACGGCCTGCGTGACGGGCCCTGCAGGTGAAGAGATTCATACCGACGAGTTGGGGCGC
ATCAAGGTGCAGTTTCACTGGGACAGAGAAGGTAAAGAGGATGAACGCACCAGCTGCTGGATCCGCGTTA
TGCACGATTGGGCCGGCAATGGTTATGGTGTTGTGAGATTGCCGCGTATTGGTCAGGAGGTACAGGTCAG
CTTTGAAGACGGCAATCCGGATAAACCGCTGATAACCGGTTGTTTGCATAACGGTGAACAGCAAACTGCA
TGGGAGTTGCCTGTCCATATGACCCGCAGCGGCATCCGGACCTGCTCAAGCCCGGGTGGTGGTGGTTCCA
ACGAACTGCGGTTTGAAGATAAAAAAGGCAAAGAAGAACTGCGCTGGCAGGCAGAAAAAGACTGGGATGC
CAAAATCCTGAGCTGCAGCCATACCCAAATCAATGGCGCACATGAAAGCGCTATTGGTGGTAATGACTAT
CGGGAAATAGAGGGTGAGCAGCACATCACCTTAGAAGCTGATACTCAGAAAGAAGTCGGTTTAAACCAGC
ACTGCACCATCCATGGTAGTCAGGAACAGCATATTGAACAAAAGTGCCTGATTCAGGCAGGGCAAAACGT
AGTCTGGCAGAGTAAGAATCAGGCTATCTACCATGCCGGGACGGAACTGACGTTACAGGCTGGCGGCAGT
TTTATCAAACTCGATCCATGTGGCATTACATTAAGCGGCCCGATGGTGACGATGAACCAGGGCGGCAGTG
CATTATCTGCAGGCAGCGAATCCGCAGCATTACCACATAAACCGGCAGGAGCACACAGTGCCGGCATCGG
TAAGGTGCCGCAGGCGAAAGCGCCGGAGAAAGTGATTAAAGTAGCGCCTGAGAAAGATTATCGGATAGTT
TATTCGGATTAG