SecReT6
Protein ID: 237814021
SecReT6 ID489
T6SS typei4b
Gene symbol-
Locus tagGBP346_A3805
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T6SS(s) in this replicon]
Location [Strand]3669098..3670198 [-]
Producttype VI secretion protein, VC_A0110 family
NoteTssG
UniProt IDC4KW65
KEGG IDbpr:GBP346_A3805
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.10E-94, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|237814021|ref|YP_002898472.1| type VI secretion protein, VC_A0110 family [Burkholderia pseudomallei MSHR346]
MQTAQRRIDPGVVERLLDEPHRFEFFQAVRLLETWFAKHDAPRHAASRPGEIVARRIGFRNTLSLGFPPS
EIERAQSYDAAGAALKDDVRRNAALEAGALSRVELTPAFFGLLGGQGALPLHYTEQIIAREQLKRDHAAH
AFFDVFSNRATALFYSAWKKYRLPLHYELDRDERYLPLLLALAGVSNDDARSTVQQGRGALLDEAIAGYA
LAARHRPVSAAYLQRTLSEYFRVPIRVEQFVGKWYDVPPDQLSVLGDVNVTLGATALVGERVWQRDMRAR
LVVGPLTKRDYEAFLPGEERAIALERMLTLLAGVTLEYEVSLVLRRAEVGASVLGAGARLGWDAFLCTRE
AGRDRADARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|237810278|ref|NC_012695.1|:c3670198-3669098 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGCAAACCGCGCAGCGGCGAATCGATCCTGGCGTAGTCGAGCGGCTGCTCGACGAGCCGCATCGCTTCG
AGTTCTTTCAGGCGGTGCGGCTGCTCGAGACCTGGTTCGCGAAGCACGATGCGCCGCGCCACGCGGCGAG
CCGGCCGGGCGAGATCGTCGCGCGGCGCATCGGCTTTCGCAATACGCTGTCGCTCGGCTTTCCGCCGAGC
GAGATCGAGCGCGCGCAGTCGTACGACGCAGCCGGCGCCGCGCTGAAGGACGACGTGCGGCGCAACGCGG
CGCTCGAGGCGGGCGCGCTGTCGCGCGTCGAGCTCACGCCAGCGTTCTTCGGGCTGCTGGGCGGCCAGGG
CGCGCTGCCGCTGCATTACACCGAGCAGATCATCGCGCGTGAGCAACTGAAGCGCGACCATGCCGCGCAC
GCATTCTTCGATGTCTTCTCGAACCGCGCGACCGCGCTGTTCTATTCGGCATGGAAGAAGTACCGTCTGC
CGCTGCATTACGAACTCGACCGCGACGAGCGCTATCTGCCGCTCCTGCTCGCACTCGCGGGCGTGTCGAA
CGACGACGCGCGCTCGACCGTGCAGCAGGGCCGCGGCGCGCTGCTCGACGAGGCGATCGCGGGCTATGCG
CTCGCCGCGCGGCATCGGCCGGTATCGGCCGCGTATCTGCAGCGCACGCTGTCCGAATATTTTCGCGTGC
CGATCCGCGTCGAGCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGATCAATTGAGCGTGCTCGGCGA
CGTGAACGTGACGCTCGGCGCGACGGCGCTCGTCGGCGAGCGCGTGTGGCAGCGCGACATGCGCGCGCGG
CTCGTCGTCGGCCCGCTGACGAAGCGCGACTACGAGGCGTTCCTGCCCGGCGAGGAGCGCGCGATCGCGC
TCGAGCGGATGCTGACGCTGCTCGCGGGCGTGACGCTCGAATACGAGGTGTCGCTCGTGCTGCGCCGCGC
GGAAGTCGGCGCGAGCGTGCTCGGCGCGGGCGCGCGGCTCGGCTGGGATGCGTTTCTCTGCACGCGCGAA
GCCGGGCGCGATCGTGCGGACGCGCGCTACGAGCTGCATGTCATTCATTGA