SecReT6
Protein ID: 237814025
SecReT6 ID489
T6SS typei4b
Gene symbol-
Locus tagGBP346_A3809
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T6SS(s) in this replicon]
Location [Strand]3673195..3674685 [-]
Producttype VI secretion protein, EvpB/family
NoteTssC
UniProt IDC4KW69
KEGG IDbpr:GBP346_A3809
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.60E-189, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|237814025|ref|YP_002898476.1| type VI secretion protein, EvpB/family [Burkholderia pseudomallei MSHR346]
MNQQTAAAQSTGVQAGTESSLLDEIVEKSKVAKSESEHARAKDLIGELVSQVLDGTVVVSDNLSATIDAR
VAELDRLISSQLSAVMHAAEFQRLESTWRGLDYLVKESNTGSTIKIKALHAPKRDLVRDFKNATEFDQSA
LFKKVYEEEFGTFGGSPFGVLVGDYEISRQPEDQYFIEQMSHVAAAAHAPFIASAAPELLGLESFADLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGAIAESFNFVEDVDGTDHDKYLWCN
ASWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRIAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDDATQEQKAQFPLREASVQVSEIPGKPGAYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|237810278|ref|NC_012695.1|:c3674685-3673195 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAATCCACCGGCGTTCAAGCCGGCACGGAATCCTCGCTGCTCGACG
AGATCGTCGAGAAGAGCAAGGTCGCGAAATCCGAATCCGAGCATGCGCGCGCGAAGGATCTGATCGGCGA
GCTCGTCAGTCAGGTGCTTGACGGCACGGTGGTGGTGTCGGACAACCTGTCGGCGACCATCGACGCGCGC
GTCGCGGAGCTCGATCGCCTGATCTCGTCGCAGCTCTCGGCCGTGATGCACGCGGCGGAGTTCCAGCGTC
TCGAGAGCACCTGGCGCGGGCTCGATTACCTGGTGAAGGAAAGCAACACCGGCTCGACGATCAAGATCAA
GGCGCTGCACGCGCCGAAGCGCGATCTCGTGCGCGATTTCAAGAACGCGACCGAGTTCGATCAGAGCGCG
CTCTTCAAGAAGGTGTACGAAGAGGAATTCGGCACGTTCGGCGGCTCGCCGTTCGGCGTGCTGGTGGGCG
ACTACGAGATCTCGCGCCAGCCGGAAGACCAGTACTTCATCGAGCAGATGTCGCACGTCGCGGCCGCCGC
GCACGCGCCGTTCATCGCGTCGGCGGCGCCCGAGCTGCTCGGGCTCGAATCGTTCGCGGATCTCGGCAAG
CCGCGCGATCTCGGCAAGGTGTTCGATACCGTTGAATACGCGAAGTGGAAGTCGTTCCGCGATTCCGAGG
ATTCGCGCTACGTCGGCCTCACGCTGCCGCGCTTTCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCGC
GATCGCGGAGAGCTTCAACTTCGTCGAGGACGTCGACGGCACCGATCACGACAAGTACCTGTGGTGCAAC
GCGTCGTGGGCGTTCGCCGCGCGCCTGACGGCGGCGTTCGACGACTTCGGCTGGTGCGCGGCGATTCGCG
GCGTCGAAGGCGGCGGCCTCGTCGAGGATCTGCCGACCCACACGTTCAAGACCGACGACGGCGAAATCGC
GCTCAAGTGCCCGACCGAGATCGCGATCACCGACCGCCGCGAGAAGGAACTGAGCGATCTCGGTTTCATC
CCGCTCGTGCACTGCAAGAATTCCGATTACGCCGCGTTCTTTGCCGCGCAGTCGGTGCAGAAACCCAAAA
AATACAGCACCGACAGCGCCAACGCGAACGCCGTCCTGTCCGCTCAGCTGCAGTACATCTTCTCGGTATC
GCGCATCGCGCATTACCTGAAGGCGATGATGCGCGACAAGATCGGCAGCTTCGCGTCCGCGCAGAACGTC
GAAACGTTCCTCAATCGCTGGATCTCGCAGTACGTGTTGCTCGACGACGACGCGACGCAGGAACAGAAGG
CGCAGTTCCCGCTGCGCGAGGCCTCCGTACAAGTGTCAGAGATTCCGGGCAAGCCGGGTGCGTATCGTTC
GGTCGCGTTTTTGCGTCCGCACTTCCAGCTCGACGAGTTGTCGATTTCTCTGCGCCTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA