SecReT6
Protein ID: 237814026
SecReT6 ID489
T6SS typei4b
Gene symbol-
Locus tagGBP346_A3810
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T6SS(s) in this replicon]
Location [Strand]3674702..3675220 [-]
Producttype VI secretion protein, VC_A0110 family
NoteTssB
UniProt IDC4KW70
KEGG IDbpr:GBP346_A3810
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.10E-59, Aligned region: 11..164
Protein Sequence: 172 a.a.     [Download]
>gi|237814026|ref|YP_002898477.1| type VI secretion protein, VC_A0110 family [Burkholderia pseudomallei MSHR346]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEIKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNF
DDVMKAIEPRATFQVENRLSEAGGKFAVDLKFRSINDFNPDEVVGQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLSNTQQLEALKKSADGGDKQGE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|237810278|ref|NC_012695.1|:c3675220-3674702 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGGCGAAGAAAGAAAGCATTCAAAAGCGCTTGCAGAAAGTGCGGCCGCCCCGCGTCCAGTTGACGTACG
AGGTCGAACGGGGCGATGCGATCGAGATCAAGGAGCTGCCGTTCGTCGTCGGGGTCGTCGGCGATCTGGC
GGGGCAGTCCGAAATCGAGCAGCCGAAGCTGCGCGATCGCAAGTTCGTCAACATCGACCGCGACAACTTC
GATGACGTGATGAAGGCGATCGAGCCGCGCGCGACGTTCCAGGTGGAGAACCGCCTGAGCGAGGCGGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGCTCGATCAACGATTTCAATCCGGACGAAGTCGTCGGGCAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCGGACCTGCGCAACAAACTGGCCGGCAAC
GACAAGCTCGAAGACCTGCTGAGCGAAGTGCTGTCGAACACGCAGCAGCTCGAAGCGCTGAAGAAGAGCG
CGGACGGCGGCGACAAGCAGGGCGAATGA