SecReT6
Protein ID: 237814029
SecReT6 ID489
T6SS typei4b
Gene symbol-
Locus tagGBP346_A3813
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T6SS(s) in this replicon]
Location [Strand]3676316..3676918 [+]
Producttype VI secretion lipoprotein, family
NoteTssJ
UniProt IDC4KW73
KEGG IDbpr:GBP346_A3813
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.20E-37, Aligned region: 11..172
Protein Sequence: 200 a.a.     [Download]
>gi|237814029|ref|YP_002898480.1| type VI secretion lipoprotein, family [Burkholderia pseudomallei MSHR346]
MTRYALPLAACILLGGCAAAVPLLGSAGSAALQMVGVGKPDVPDSQKPPRNLGLTLYAAQNLNAANDNRP
LALVVRLYALKDPTSFQQAPFDSFTDPTKEKTALGADLLSVREITLIPGQHYNATEKVSREAQAFGVVAL
FRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTGGTVIPSQQGMPTQRLDLLSSVNCG
 
Nucleotide Sequence: 603 bp     [Download]
>gi|237810278|ref|NC_012695.1|:3676316-3676918 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
GTGACTCGTTACGCGCTGCCGCTCGCCGCCTGCATTCTGCTCGGCGGCTGCGCGGCCGCCGTGCCGCTCC
TCGGTTCGGCGGGCAGCGCCGCGCTGCAAATGGTGGGCGTCGGCAAACCCGACGTGCCCGATTCGCAGAA
GCCGCCGCGCAATCTCGGCCTCACGCTCTATGCGGCACAGAACCTCAACGCCGCGAACGACAACCGTCCG
CTCGCGCTCGTCGTGCGCCTCTACGCGCTGAAAGATCCGACGTCGTTCCAGCAGGCGCCGTTCGACAGCT
TCACCGATCCGACGAAAGAAAAGACCGCGCTCGGCGCCGATCTGCTGAGCGTGCGCGAAATCACGCTGAT
TCCGGGGCAGCACTACAACGCGACCGAAAAGGTGTCGCGCGAAGCGCAGGCATTCGGCGTCGTCGCGCTC
TTTCGCGATCCGGCGCTACAACGCTGGAAACTGACTTTCGATCCGGCGAAATCCGAGAAATCCGGCATAA
TCATTGGCCTGCACAACTGCGCGATGACCGTGACGGGCGGCACCGTCATCCCTTCGCAGCAAGGCATGCC
GACGCAGCGGCTCGATTTGCTGTCGTCGGTGAACTGCGGGTGA