SecReT6
Protein ID: 237814030
SecReT6 ID489
T6SS typei4b
Gene symbol-
Locus tagGBP346_A3814
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T6SS(s) in this replicon]
Location [Strand]3676967..3678373 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssK
UniProt IDC4KW74
KEGG IDbpr:GBP346_A3814
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-135, Aligned region: 39..466
Protein Sequence: 468 a.a.     [Download]
>gi|237814030|ref|YP_002898481.1| type VI secretion protein, VC_A0110 family [Burkholderia pseudomallei MSHR346]
MPNATRINRPTAQSHLSGFDMSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRF
DRDALGSNVLRASELSLVFPDGALYSAPQADELPPPIALDTLPEGINEFTFYLALHPLRETGSNYADDRD
AGFVSRFVSEQASVADHFTDAAEADITFLKTNVKLIAHSEPRDQLLSIPLVRVRRTATSGFEIDDGFVPP
CLAIEASPILHQRLRQLIDALQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTASAAFAALAHLHQHS
ALHPERLFQELLRLAGQLMTFSKGYVLADLPAYRHDDPGPGFARLDSILRELLETVISTRYFAITLEEVR
PSFHVGRLDSGKIDDKTAFYLAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLAYTPQVPPA
IPVRPGACYFALDTRSPLYERMLQAQSAMIYAPSGINDLKFELIAVTS
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|237810278|ref|NC_012695.1|:3676967-3678373 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
TTGCCGAACGCGACGCGAATTAACCGACCAACGGCCCAATCACATTTAAGCGGATTTGACATGAGTTATT
CGGCCAAGGTGCTCTGGGGAGAAGGCCTCTTTCTGAGGCCGCAGCACTTTCAGCGGCAGGACGCGTATCA
CGAAGCGCGCCTGTTCGAATCGATCCAGGCGATCCAGCCGTACAACTGGGGCGTGCGTTCGGTGCGGTTC
GATCGCGACGCGCTCGGCAGCAACGTGCTGCGCGCGAGCGAACTGTCGCTCGTGTTTCCGGACGGCGCGC
TCTACTCCGCGCCGCAAGCCGACGAACTGCCGCCGCCCATCGCGCTCGACACGCTGCCCGAAGGCATCAA
CGAATTCACGTTCTACCTCGCGCTGCACCCGCTGCGCGAGACCGGCTCGAACTACGCGGACGACCGCGAC
GCCGGCTTCGTGTCGCGCTTCGTCAGCGAACAGGCGAGCGTTGCCGATCACTTCACCGACGCCGCGGAAG
CGGACATCACGTTCCTGAAGACGAACGTGAAGCTGATCGCGCACAGCGAGCCGCGCGACCAGTTGCTGTC
GATCCCGCTCGTACGCGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACGGCTTCGTGCCGCCG
TGCCTCGCGATCGAGGCGTCGCCGATCCTGCACCAGCGCCTGCGCCAGTTGATCGACGCGCTGCAGGCGA
AGGTGAATGCACTGTACGGTTTCCATCGCGAGCCGACGAAGAACATCATCGAGTTCCGCTCGGGCGACAT
CGCATCGTTCTGGCTGCTGCACACGGCGAGCGCCGCGTTCGCCGCGCTCGCGCACCTGCACCAGCATTCG
GCCTTGCATCCGGAGCGGCTGTTCCAGGAACTACTGCGCCTCGCGGGCCAGTTGATGACGTTCTCGAAGG
GCTACGTGCTCGCCGATCTGCCCGCGTACCGGCATGACGATCCGGGCCCGGGCTTCGCGCGGCTCGATTC
GATCCTGCGCGAGCTGCTCGAGACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGAGGAAGTGCGG
CCGTCGTTCCATGTCGGGCGGCTCGACTCGGGCAAGATCGACGACAAGACCGCGTTCTATCTCGCGGTGT
CGGCCGACATGCCGTCGGTCGAACTCGTCGATGCGGTGCCCGCGCGCTTCAAGGTGGGCGCGCCGGACGA
CGTCGACAAGCTCGTGCTCTCCGCGATGCCGGGCGTGCGCCTCGCGTACACGCCGCAGGTGCCGCCCGCG
ATTCCCGTGCGCCCGGGCGCATGCTATTTCGCACTCGATACGCGCAGCCCGCTCTATGAGCGGATGCTGC
AGGCCCAGTCGGCGATGATCTATGCGCCGTCCGGAATCAACGATCTCAAATTCGAACTGATCGCCGTCAC
GTCATGA