SecReT6
Protein ID: 237814031
SecReT6 ID489
T6SS typei4b
Gene symbol-
Locus tagGBP346_A3815
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T6SS(s) in this replicon]
Location [Strand]3678370..3679155 [+]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDC4KW75
KEGG IDbpr:GBP346_A3815
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.00E-57, Aligned region: 31..232
Protein Sequence: 261 a.a.     [Download]
>gi|237814031|ref|YP_002898482.1| type IV / VI secretion system protein, DotU family [Burkholderia pseudomallei MSHR346]
MSYAPSLFGGNTPPPAPQTASSTDAGFQARSLVDLLYDGFFMLFLLKNGREPNDASEFGTRIQEFLSEFE
RGAKKLNIAADDVYAAKFAFCAAIDESVLSSPFKIRADWERRPLQLVLFGEQLAGEKFYQYLEECRAQGA
ARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIANMKGKRAPFAPHWPLPDQISHRLKREVPL
WAIGAVFALVGLLAFVGLNTYLKDSTVQALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 786 bp     [Download]
>gi|237810278|ref|NC_012695.1|:3678370-3679155 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGAGTTACGCGCCCTCCCTCTTCGGCGGCAACACGCCGCCCCCCGCGCCGCAAACGGCTTCGTCGACCG
ACGCCGGCTTCCAGGCGCGCTCGCTCGTCGATCTGCTGTACGACGGCTTCTTCATGCTGTTCCTGCTGAA
GAACGGCCGCGAGCCGAACGACGCGTCGGAATTCGGCACGCGCATTCAGGAATTCCTGAGCGAGTTCGAA
CGCGGCGCGAAGAAGCTCAACATCGCCGCCGACGACGTCTATGCGGCGAAGTTCGCGTTTTGCGCGGCGA
TCGACGAATCGGTGCTGTCGTCGCCGTTCAAGATCCGCGCGGACTGGGAGCGCCGGCCGTTGCAGCTCGT
GCTGTTCGGCGAGCAACTCGCGGGCGAGAAGTTCTATCAGTACCTCGAAGAATGCCGCGCGCAGGGCGCG
GCGCGGCTGCAGTCGCTCGAGGTGTTCCATATGTGCCTGCTGCTCGGCTTCCAGGGCAAGTATCTGCTCG
AAGGGCCGGAAAAGCTCGCGTATCTGACCGCACGGCTTGGCGACGAGATCGCGAACATGAAGGGCAAGCG
CGCACCGTTCGCGCCGCATTGGCCGCTGCCGGACCAGATCTCGCACCGGCTCAAGCGCGAGGTGCCGCTG
TGGGCGATCGGAGCGGTGTTCGCGCTCGTCGGGCTGCTGGCGTTCGTCGGGCTGAATACGTATTTGAAAG
ACAGCACCGTGCAGGCGCTCGCGCCTTATTCGCAAGTCATCAAGGTGGGGCCGGAGTCGGCTAATTTGAC
GATTTCGTTGCCTTGA