SecReT6
Protein ID: 238023631
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01400
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]154493..155251 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDC5ALC7
KEGG IDbgl:bglu_2g01400
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-27, Aligned region: 7..227
Protein Sequence: 252 a.a.     [Download]
>gi|238023631|ref|YP_002907863.1| unnamed protein product [Burkholderia glumae BGR1]
MSDEADSLITLMRDTALHAALLSSGAMLPPAHVWRARCLALAEALRQAMLDAGYPASAAEEASLAQCVLL
DELSLRALPAGQRDEWLREPLQASLHEVTDGAARVWARIDALLRGERQNRLALEWYGIVLTLGFEGGRRD
RDDVARRLWTMLDGAARPARHAAMLPSRQLTLARSGPVEPAEPPPLRISPTPPPPPRGGLSILPGFVIGV
IVPAVLAVALWIFFDARLGEVAGRLASSEVLPVAIPPQGDAQ
 
Nucleotide Sequence: 759 bp     [Download]
>gi|339717964|ref|NC_012721.2|:154493-155251 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGTCAGACGAAGCCGATTCGCTGATCACGCTGATGCGTGACACCGCCCTGCACGCCGCGTTGCTGTCGA
GCGGCGCGATGCTGCCGCCTGCACACGTCTGGCGAGCGCGCTGTCTGGCGCTCGCCGAAGCGTTGCGACA
GGCGATGCTCGATGCCGGCTACCCGGCGTCCGCCGCCGAGGAGGCGAGTCTCGCGCAGTGCGTGCTGCTC
GACGAACTGAGCTTGCGCGCCTTGCCGGCCGGACAACGCGACGAATGGCTGCGCGAGCCGCTGCAGGCGA
GCCTCCATGAGGTGACCGACGGCGCCGCGCGAGTCTGGGCGCGGATCGACGCGCTGCTGCGTGGCGAGCG
GCAAAACCGCTTGGCGCTGGAGTGGTATGGCATCGTGTTGACGCTCGGCTTCGAGGGCGGCCGCCGCGAT
CGGGACGATGTCGCGCGGCGTCTGTGGACGATGCTCGACGGCGCTGCGCGTCCTGCCAGGCACGCTGCGA
TGTTGCCGTCTCGTCAATTGACGCTGGCGCGATCCGGGCCGGTGGAGCCGGCCGAGCCACCGCCGCTGCG
AATCTCGCCGACGCCGCCTCCGCCCCCTCGAGGCGGTCTGTCAATCCTGCCGGGATTCGTGATCGGCGTG
ATCGTGCCGGCGGTGCTCGCCGTCGCGCTATGGATCTTCTTCGACGCACGACTTGGCGAGGTCGCTGGCC
GCTTGGCAAGCAGCGAGGTTCTGCCCGTCGCGATTCCGCCGCAGGGAGACGCGCAATGA