SecReT6
Protein ID: 238023633
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01420
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]157164..157697 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDC5ALC9
KEGG IDbgl:bglu_2g01420
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.10E-61, Aligned region: 11..164
Protein Sequence: 177 a.a.     [Download]
>gi|238023633|ref|YP_002907865.1| unnamed protein product [Burkholderia glumae BGR1]
MSVSNNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPIEALPAVAERKFFNIDIDNF
DERMKAMKPRVAFSVPNTLTNQGELMVDMTFESMDDFSPAAVARKVDALAQLLDARTQLANLQTYMDGKA
GAESLVSKVLRDPALLEALAKAPKPRSASSDDATAGE
 
Nucleotide Sequence: 534 bp     [Download]
>gi|339717964|ref|NC_012721.2|:157164-157697 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGTCCGTTTCCAACAATTCTCAGAAATTCATTGCGCGTAATCGCGCGCCGCGCGTGCAGATCGAATACG
ACGTGGAAATCTACGGCTCGGAAAAGAAGGTCGAGTTGCCGTTCGTGATGGGCGTGCTGGCCGATCTGTC
AGGCAAACCGATCGAGGCGTTGCCGGCCGTAGCCGAACGCAAGTTCTTCAATATCGACATCGACAATTTC
GACGAACGCATGAAGGCGATGAAGCCGCGCGTCGCGTTCTCGGTGCCGAACACGCTGACGAATCAGGGAG
AGTTGATGGTCGACATGACCTTCGAGAGCATGGACGATTTCTCGCCCGCTGCCGTGGCGAGGAAGGTCGA
CGCGCTCGCGCAACTGCTCGACGCACGCACACAGCTCGCCAACCTGCAAACCTACATGGACGGCAAGGCC
GGGGCCGAAAGTCTCGTCAGCAAAGTATTGCGTGATCCCGCCTTGCTCGAAGCACTCGCCAAGGCGCCCA
AGCCGCGGTCCGCATCCTCCGACGACGCAACGGCCGGTGAGTGA