SecReT6
Protein ID: 238023634
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01430
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]157775..159277 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDC5ALD0
KEGG IDbgl:bglu_2g01430
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.20E-194, Aligned region: 67..494
Protein Sequence: 500 a.a.     [Download]
>gi|238023634|ref|YP_002907866.1| unnamed protein product [Burkholderia glumae BGR1]
MVERQSKAHVGAAPSVVSQSDFNALLSREFKPKTERAREAVQSAVQTLAQQALLTSTVLADDAYKNIEAI
IGEIDRKLSEQINLVLHHDDFQKLESAWRGLHYLVTNTETDERLKIRFMDVSKDDLRRVMKRYKGVAWDQ
SPFFKQIYEEEYGQLGGEPYGCLIADYYFDHTPPDVDLLASIAKVAAAAHAPFIAGAAPSVLQMDTWQEL
ANPRDLTKIFTQNLEYAPWNSLRNSEDSRYIGLAMPRFLSRLPYGIKTNPVDEFDFEEATDGADHRKYVW
SNAAYAMAVNINRSFKHYGWCTLIRGVESGGVVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNG
FIPLIHRKNTDYAAFIGAQSLQKPVEYYDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERD
EMQQWLNEWVMNYVDADPANSSQETKARRPLAAAEVVVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRLV
AKLPLVKQAA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|339717964|ref|NC_012721.2|:157775-159277 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGGTCGAACGTCAATCGAAGGCTCACGTGGGGGCGGCGCCGAGCGTCGTCAGCCAGTCCGATTTTAACG
CGCTGCTGTCGCGCGAATTCAAGCCGAAAACCGAGCGGGCCCGAGAGGCCGTGCAGAGCGCCGTGCAGAC
GCTCGCGCAACAGGCGCTGCTCACCTCGACAGTGCTCGCCGACGATGCTTACAAGAACATCGAGGCGATC
ATCGGCGAGATCGATCGAAAACTCTCCGAGCAGATCAATCTGGTGCTGCATCACGACGATTTCCAGAAGC
TCGAGAGTGCGTGGCGTGGCCTGCATTATCTGGTCACCAACACCGAGACCGACGAGCGACTCAAGATCCG
CTTCATGGACGTCTCGAAGGACGACCTGCGGCGCGTGATGAAGCGCTACAAGGGCGTGGCCTGGGATCAG
AGCCCGTTCTTCAAGCAAATCTACGAGGAGGAGTACGGCCAGCTCGGCGGTGAGCCATACGGCTGCCTGA
TCGCCGATTACTACTTCGACCACACGCCGCCCGATGTCGATTTGCTGGCCTCGATCGCCAAGGTTGCCGC
TGCCGCGCACGCGCCGTTTATCGCCGGTGCCGCACCGTCGGTGCTCCAGATGGACACCTGGCAGGAACTC
GCGAATCCGCGCGACCTGACCAAGATATTTACCCAGAACCTCGAATACGCGCCGTGGAATTCGCTGCGCA
ACTCGGAGGACTCGCGCTACATCGGGCTCGCGATGCCGCGCTTCTTGTCGCGCTTGCCATACGGCATCAA
AACGAATCCGGTCGACGAGTTCGACTTCGAGGAAGCGACCGACGGTGCCGATCATCGCAAGTACGTATGG
TCGAACGCGGCCTATGCGATGGCAGTGAACATCAATCGCTCGTTCAAGCACTACGGCTGGTGCACCCTGA
TTCGCGGCGTGGAGAGTGGCGGGGTAGTGGAGAATCTGCCCTGCCACACGTTCCCGACCGACGATGGTGG
GGTCGACATGAAGTGCCCGACCGAAATCGCGATTTCCGATCGCCGCGAGGCGGAGCTGGCGAAAAACGGC
TTCATACCGCTGATTCATCGCAAGAACACCGATTACGCGGCATTCATCGGCGCGCAGTCGCTGCAGAAGC
CGGTCGAATACTACGACCCGGACGCCACCGCGAACGCCAATCTCTCGGCGCGCCTGCCTTATTTGTTCGC
GTGCTCGCGCTTCGCACATTACCTGAAATGCATCGTGCGCGACAAGATCGGCTCGTTCAAGGAGCGCGAC
GAGATGCAGCAATGGCTCAATGAGTGGGTGATGAACTACGTCGACGCGGATCCGGCGAATTCATCGCAGG
AGACCAAGGCCCGGCGGCCTCTCGCGGCCGCCGAGGTGGTAGTCGAGGATGTCGAGGGCAATCCCGGCTA
CTACCAGGCGAAGTTTTTCCTGCGCCCGCATTTCCAGCTCGAGGGCCTGACGGTGTCGCTGCGTCTCGTC
GCCAAGCTGCCGCTAGTGAAGCAAGCGGCCTGA