SecReT6
Protein ID: 238023635
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01440
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]159409..159891 [+]
Producttype VI secretion system effector
NoteTssD
UniProt IDC5ALD1
KEGG IDbgl:bglu_2g01440
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-43, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|238023635|ref|YP_002907867.1| unnamed protein product [Burkholderia glumae BGR1]
MAQDIFLKLNGIDGESEDASHKNEIDVLSWSWNVSQQSNMHVGSGGGAGRATVDDLTFEHFIDRSTPNLT
QYCLTGKHIDEARLVVRKAGGNPLEYLKLTMNDVLVTSVHPSGVSESESRPREVVSLSFSRMKQEYVVQN
AQGGSGGAITATFDIKKNSA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|339717964|ref|NC_012721.2|:159409-159891 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGGCACAAGACATCTTTCTCAAACTCAACGGGATCGATGGTGAGTCGGAGGACGCCAGCCACAAGAATG
AAATCGACGTTCTTAGCTGGTCGTGGAATGTCTCGCAGCAGTCGAACATGCACGTCGGTTCCGGAGGCGG
TGCGGGTCGGGCGACCGTTGACGACCTCACCTTCGAGCACTTCATCGACCGTTCGACGCCGAACCTCACG
CAGTACTGCCTGACGGGCAAGCACATCGACGAGGCCAGGCTCGTCGTGCGCAAGGCAGGCGGCAACCCGC
TCGAATACCTCAAGCTGACCATGAACGACGTGCTGGTCACTTCGGTGCACCCGTCTGGCGTGAGCGAAAG
CGAATCGCGACCGCGTGAAGTGGTGTCGCTTTCGTTCTCGCGCATGAAGCAGGAGTACGTCGTGCAGAAT
GCGCAAGGCGGCAGCGGCGGGGCGATCACGGCCACCTTCGACATCAAGAAGAACAGCGCCTGA