SecReT6
Protein ID: 238023636
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01450
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]160040..160594 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDC5ALD2
KEGG IDbgl:bglu_2g01450
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-39, Aligned region: 26..175
Protein Sequence: 184 a.a.     [Download]
>gi|238023636|ref|YP_002907868.1| unnamed protein product [Burkholderia glumae BGR1]
MASNPLFRCAAMLGIMGWLAIGVAALGLGACGGAPATAVKEPVKLRLRVVASEGVNPNEWGVASPVLVRI
YELKSAAAFSNADFFTLQDHDRKAIGDDVLAIDEFILRPGEERDIERESHRAATAIGVLAGYRELGKSVW
RGIYRLPPRPDAAWYRITIPVQRQNLTVRLGRRAVSIYQSDQSR
 
Nucleotide Sequence: 555 bp     [Download]
>gi|339717964|ref|NC_012721.2|:160040-160594 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGGCTTCAAATCCACTTTTTCGGTGCGCGGCGATGCTGGGCATCATGGGCTGGCTTGCAATCGGCGTGG
CCGCCCTGGGGCTCGGAGCGTGCGGCGGGGCGCCGGCTACGGCGGTGAAGGAGCCGGTGAAGCTTCGGTT
GCGCGTGGTCGCGAGCGAAGGTGTCAACCCGAACGAGTGGGGCGTCGCGTCTCCGGTGCTGGTGCGGATC
TACGAGCTGAAATCGGCGGCGGCCTTCTCGAATGCCGATTTTTTTACGTTGCAGGATCACGACCGCAAGG
CCATTGGCGACGACGTGCTCGCCATCGACGAATTCATCCTTCGTCCCGGCGAGGAGCGCGACATCGAGCG
GGAGTCCCATCGTGCCGCCACCGCGATCGGCGTGCTGGCAGGCTACCGCGAGCTCGGAAAATCGGTTTGG
CGCGGCATCTATCGGCTACCGCCCCGCCCCGACGCCGCATGGTATCGAATCACGATTCCGGTCCAACGTC
AGAACCTGACTGTCCGCCTCGGCCGGCGCGCGGTTTCCATTTACCAATCGGATCAGTCGCGATGA