SecReT6
Protein ID: 238023637
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01460
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]160591..161940 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDC5ALD3
KEGG IDbgl:bglu_2g01460
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.20E-138, Aligned region: 20..447
Protein Sequence: 449 a.a.     [Download]
>gi|238023637|ref|YP_002907869.1| unnamed protein product [Burkholderia glumae BGR1]
MSWYNKVVWSEGLFLRPQLFQQQERYFEYLAHRRSVALSPFFWGFGQYEIDQESLSFGKLVFKGGSGVFP
DGTPFDVPSHTPPPPPLTIEPAHQDQLIYLAVPLRLPNTEEVTFAEQSGSLARYVAYDTELRDSNAIGQG
PKLVQLANLRLRLLPEKELTQSWIGIALTRVKALHADGAASLHVTDHIPPVSGYGANPLLREWTMQLHGL
AKLRADALAARLSGTDGRPGAAAEVADYLLLQVLNRYEPLLEHICQIEEIPPVVLYRELAMLAGELSTFV
RPQTRRPLTAPGYDHAQLYRSIKPLVDEVHHLLNQVLIRSAQPIPISEQPHGIRTVAVLPNELAGYSSLV
LAVSAQLSPDVLQQQFLAQTKISHPQRLPELVRSHLPGLTMVPLPVPPRQIPFNSNFIYFELSRTGPFWD
QIARQGGLAMHIAGHFPELKLELWGVRQK
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|339717964|ref|NC_012721.2|:160591-161940 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGAGTTGGTATAACAAGGTGGTCTGGAGCGAAGGATTGTTCTTGCGTCCGCAGTTGTTCCAACAGCAAG
AACGATATTTCGAATATCTCGCGCATCGCAGAAGCGTTGCGCTGAGTCCGTTTTTCTGGGGTTTCGGCCA
GTACGAGATCGACCAGGAGTCCTTGTCGTTCGGCAAGCTCGTGTTCAAGGGCGGCAGCGGCGTGTTTCCG
GATGGCACGCCGTTCGACGTGCCGAGCCACACGCCGCCGCCGCCGCCGCTCACGATCGAGCCCGCGCATC
AGGACCAACTGATCTACCTGGCCGTGCCGCTGCGCTTGCCGAACACCGAGGAAGTGACGTTCGCCGAGCA
GAGCGGCTCGCTCGCACGCTACGTTGCCTACGACACCGAACTGCGCGACAGCAACGCCATCGGTCAGGGG
CCGAAGCTCGTCCAGCTCGCGAACCTGCGGCTGCGGCTGCTGCCCGAGAAGGAACTCACGCAGTCGTGGA
TCGGCATCGCACTCACGCGCGTGAAGGCACTGCACGCTGACGGCGCGGCGTCGCTACACGTGACCGATCA
CATTCCGCCCGTTTCCGGCTACGGCGCCAATCCGTTGCTGCGCGAATGGACGATGCAACTGCATGGCCTC
GCCAAGCTGCGCGCCGACGCGCTGGCCGCGCGCCTGTCCGGCACTGACGGCCGGCCCGGCGCGGCCGCCG
AGGTGGCCGACTATTTGCTGCTGCAGGTGCTGAATCGTTACGAGCCGCTGCTCGAGCACATCTGTCAAAT
CGAGGAAATCCCACCGGTGGTGTTATACCGCGAGCTGGCGATGCTGGCGGGCGAGCTGTCGACCTTCGTG
CGACCGCAGACGCGGCGTCCGCTCACGGCGCCGGGCTATGACCACGCGCAGTTGTATCGCAGCATCAAGC
CGCTGGTCGACGAGGTGCACCATCTGCTCAACCAGGTGTTGATCCGCAGCGCTCAACCGATCCCGATCAG
CGAGCAGCCGCACGGCATTCGTACCGTCGCCGTGCTGCCGAACGAACTGGCCGGCTATTCCAGTCTGGTG
CTCGCAGTCAGCGCCCAGCTATCACCGGATGTGCTGCAGCAGCAGTTCCTCGCGCAGACCAAGATCAGCC
ATCCGCAACGCCTGCCCGAACTGGTCCGCTCGCATCTGCCGGGATTGACGATGGTGCCGCTGCCGGTGCC
GCCACGGCAGATTCCCTTCAATTCGAATTTCATTTATTTCGAGCTGTCCCGTACCGGGCCGTTCTGGGAT
CAGATCGCTCGGCAAGGTGGTCTCGCGATGCATATCGCCGGGCATTTCCCTGAGCTCAAGCTTGAACTAT
GGGGCGTGCGCCAGAAATGA