SecReT6
Protein ID: 238023638
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01470
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]161937..163253 [+]
Producthypothetical protein
NoteTssL
UniProt IDC5ALD4
KEGG IDbgl:bglu_2g01470
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.80E-62, Aligned region: 62..268
OmpA [PF00691], Evalue: 3.60E-15, Aligned region: 332..430
Protein Sequence: 438 a.a.     [Download]
>gi|238023638|ref|YP_002907870.1| unnamed protein product [Burkholderia glumae BGR1]
MSTHAHDEAFSFLAEPGQGETVSGAGASGGAFGPPPAAMDSVAFEPPEDAATRLARVQAARNPLLEAARS
LLRMLGDMPASLESSAAVESLRALLVREVAAFQKVCDKANLPWKHVAAVRYALCTGLDEAANRTQWGGGG
IWAARSLLIRFEGEVDGGEKFFLLIGRMATDPQEYVDVLEVMYRILGLGFEGRYSVAEDGSRHLEEIRQR
LLTLVSGARDTMRLEFSPHWRGEAYDQLKLLRSVPVWATASVAALVVFGRFGWYTYHLLTVRNPLEARIL
AIGRSPAPAAHAAPAHLPLRLSVLLKDEIARGELTVDEDARHSKVVFRGDTMFVTGKSRVRPELEPVLAK
VAREVARVGGRVIVTGYTDSQPIHTREFPDNLVLSQKRAAFVADVLKAHGTPSERIVSIGKGDAQPVADN
ATPQGRSRNRRVEVLVVQ
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|339717964|ref|NC_012721.2|:161937-163253 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGAGCACGCATGCTCATGACGAGGCCTTCAGTTTCCTCGCGGAGCCGGGGCAGGGCGAGACCGTGTCCG
GCGCGGGCGCGTCGGGGGGCGCTTTCGGGCCGCCCCCTGCGGCCATGGACAGCGTCGCGTTCGAGCCACC
CGAGGACGCGGCCACGCGCCTCGCGCGCGTACAAGCTGCGCGCAATCCCTTGCTCGAGGCGGCGCGCTCG
TTGCTGCGCATGCTCGGCGACATGCCGGCCTCGCTCGAATCGTCGGCGGCCGTCGAAAGCCTGCGCGCGC
TGCTGGTGCGCGAGGTCGCCGCGTTTCAGAAGGTCTGCGACAAGGCGAATTTGCCATGGAAGCACGTCGC
TGCGGTGCGCTACGCACTGTGCACCGGACTCGACGAGGCGGCCAATCGCACCCAGTGGGGCGGCGGCGGC
ATCTGGGCCGCGCGCAGCCTGTTGATCCGTTTCGAGGGCGAGGTCGACGGCGGCGAGAAATTCTTCCTGC
TGATCGGTCGGATGGCGACAGACCCGCAGGAGTACGTCGACGTGCTCGAGGTGATGTACCGGATTCTCGG
CCTCGGCTTCGAGGGGCGCTATAGCGTCGCCGAGGATGGCAGCCGCCATCTCGAGGAGATACGCCAGCGG
CTGCTCACCCTCGTGAGCGGCGCGCGCGACACGATGCGCTTGGAATTCTCGCCACATTGGCGCGGCGAGG
CGTATGACCAGTTGAAATTGTTGCGCAGCGTCCCCGTGTGGGCCACGGCGAGCGTCGCTGCGCTCGTCGT
GTTTGGTCGCTTCGGCTGGTACACCTATCACTTGTTAACGGTCCGCAATCCGCTGGAGGCGCGGATCCTC
GCGATCGGCCGCTCGCCCGCGCCGGCCGCACATGCAGCGCCGGCGCATCTGCCGCTACGGCTGTCGGTGC
TGCTCAAGGATGAAATCGCGCGTGGCGAGTTGACGGTCGACGAGGACGCGCGGCACAGCAAGGTGGTGTT
CCGGGGCGACACCATGTTCGTCACCGGCAAGAGCCGCGTCCGACCCGAGCTGGAGCCGGTTCTGGCAAAG
GTGGCGCGCGAGGTCGCCCGGGTGGGCGGGCGTGTGATCGTGACCGGCTATACCGACAGCCAGCCGATCC
ATACCCGCGAGTTTCCCGACAATCTGGTCCTGTCCCAGAAGCGTGCGGCGTTCGTCGCCGACGTGCTGAA
GGCGCATGGCACGCCCTCCGAGCGGATTGTGTCGATCGGCAAGGGCGACGCGCAGCCGGTGGCCGACAAT
GCCACGCCGCAGGGGCGCTCGCGCAACCGGCGCGTGGAAGTCCTCGTGGTGCAATGA